Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LHU6

Protein Details
Accession A0A4S4LHU6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
150-171KLRVRLGAFRARRRVRRHVGLABasic
NLS Segment(s)
PositionSequence
150-169ALKLRVRLGAFRARRRVRRH
Subcellular Location(s) nucl 8.5cyto_nucl 8.5, cyto 7.5, extr 7, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MDHSTEDASPHDASPLRTALLLTADDNDEFEALPAXRFSGRGLGLEQALRRREAEWAEYEGDDAQPHRDVEKRMQRAVDLASPFSTARFGNGALDLDPDADADARRHAGKEDAHSTVPRCLRFGFGSSNANSSSSASASTTWGWRARXAALKLRVRLGAFRARRRVRRHVGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.19
5 0.19
6 0.16
7 0.16
8 0.15
9 0.12
10 0.12
11 0.13
12 0.12
13 0.13
14 0.12
15 0.1
16 0.09
17 0.08
18 0.11
19 0.1
20 0.1
21 0.1
22 0.11
23 0.11
24 0.11
25 0.13
26 0.1
27 0.11
28 0.12
29 0.13
30 0.13
31 0.15
32 0.17
33 0.21
34 0.21
35 0.2
36 0.2
37 0.19
38 0.22
39 0.22
40 0.23
41 0.19
42 0.21
43 0.21
44 0.2
45 0.2
46 0.17
47 0.15
48 0.13
49 0.1
50 0.09
51 0.09
52 0.1
53 0.11
54 0.14
55 0.16
56 0.24
57 0.33
58 0.36
59 0.36
60 0.36
61 0.35
62 0.33
63 0.32
64 0.27
65 0.19
66 0.15
67 0.13
68 0.14
69 0.14
70 0.12
71 0.12
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.08
78 0.08
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.08
91 0.08
92 0.09
93 0.09
94 0.13
95 0.15
96 0.19
97 0.22
98 0.23
99 0.24
100 0.25
101 0.26
102 0.28
103 0.3
104 0.26
105 0.24
106 0.22
107 0.24
108 0.23
109 0.25
110 0.23
111 0.22
112 0.26
113 0.26
114 0.27
115 0.25
116 0.24
117 0.22
118 0.18
119 0.16
120 0.12
121 0.12
122 0.1
123 0.11
124 0.12
125 0.13
126 0.14
127 0.16
128 0.19
129 0.2
130 0.2
131 0.23
132 0.24
133 0.3
134 0.33
135 0.39
136 0.42
137 0.48
138 0.48
139 0.5
140 0.48
141 0.44
142 0.45
143 0.45
144 0.48
145 0.5
146 0.59
147 0.63
148 0.7
149 0.75
150 0.81
151 0.81