FuNGI

A0A4S4KXQ1

Protein Details

Accession

A0A4S4KXQ1

Localization Confidence

Medium

Confidence Score

14.4

NoLS Segment(s)

Position	Sequence	Protein Nature
446-471	GAGSRLRARRYRWRAGFRLRARIRRF	Hydrophilic

NLS Segment(s)

Position	Sequence
440-471	RAAAXQGGAGSRLRARRYRWRAGFRLRARIRR

Subcellular Location(s)

nucl 16, cyto 7, mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR019341 Alpha/Gamma-adaptin-bd_p34

Amino Acid Sequences

MTQSTMDTEDPSSASCRIVVVSSSLDTSRDVATRIKALSGDDSETLAASEVIHWTIKNKYYTASVHFHPIHLEGLESIELDDVPAIIYAWKENEPYKDHLKQVSEHTSAYEPEVSLAISMAPSADEGLEDFLFEHGFEYIDGHSQVTDRSASLSGSTDAPGFHRALDALSTIMWPSMVQAEAARTKVTKVAGQRAPSTYADGLDEVDLDLQAIMNAASTSGGKSAIQHEMEMLERWLENDGGDDHGYSSINDTSGAYADVNADVDNDDYASLYSHSRSFVTVKSDDPWSTEPQPGYRAEKDTTGTPGFDDDFAEFVSAPPAAGDKPAHAASTGATGYADLESDSDPELPSEAEIHAASARIFGSSLSSPFPAPAPAQPDTSTAHRDSAPALAPAQDKGTGDAVDADADTDAPAFDLTRVLGALEGMKAEIAQIPDTRARRAAAXQGGAGSRLRARRYRWRAGFRLRARIRRFALHPFYLLAMSML

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.16
2	0.15
3	0.14
4	0.13
5	0.14
6	0.14
7	0.13
8	0.14
9	0.15
10	0.16
11	0.16
12	0.16
13	0.16
14	0.17
15	0.17
16	0.16
17	0.17
18	0.19
19	0.22
20	0.25
21	0.25
22	0.25
23	0.23
24	0.24
25	0.27
26	0.25
27	0.25
28	0.21
29	0.21
30	0.19
31	0.18
32	0.17
33	0.12
34	0.1
35	0.07
36	0.07
37	0.08
38	0.09
39	0.1
40	0.1
41	0.12
42	0.18
43	0.24
44	0.26
45	0.25
46	0.26
47	0.3
48	0.34
49	0.38
50	0.37
51	0.32
52	0.38
53	0.38
54	0.37
55	0.33
56	0.31
57	0.26
58	0.22
59	0.2
60	0.12
61	0.13
62	0.12
63	0.11
64	0.09
65	0.08
66	0.07
67	0.07
68	0.07
69	0.05
70	0.05
71	0.05
72	0.05
73	0.05
74	0.05
75	0.07
76	0.09
77	0.11
78	0.13
79	0.16
80	0.21
81	0.25
82	0.3
83	0.37
84	0.4
85	0.43
86	0.46
87	0.45
88	0.44
89	0.47
90	0.49
91	0.43
92	0.38
93	0.36
94	0.33
95	0.3
96	0.29
97	0.23
98	0.15
99	0.14
100	0.14
101	0.11
102	0.09
103	0.09
104	0.07
105	0.05
106	0.05
107	0.04
108	0.04
109	0.04
110	0.04
111	0.04
112	0.04
113	0.04
114	0.07
115	0.06
116	0.06
117	0.07
118	0.07
119	0.07
120	0.07
121	0.07
122	0.05
123	0.05
124	0.05
125	0.06
126	0.06
127	0.08
128	0.09
129	0.08
130	0.08
131	0.09
132	0.09
133	0.09
134	0.09
135	0.07
136	0.09
137	0.1
138	0.09
139	0.1
140	0.11
141	0.11
142	0.11
143	0.11
144	0.1
145	0.1
146	0.11
147	0.13
148	0.11
149	0.1
150	0.1
151	0.09
152	0.09
153	0.1
154	0.08
155	0.06
156	0.06
157	0.06
158	0.06
159	0.06
160	0.05
161	0.04
162	0.04
163	0.05
164	0.05
165	0.06
166	0.06
167	0.09
168	0.11
169	0.12
170	0.12
171	0.11
172	0.11
173	0.14
174	0.15
175	0.15
176	0.17
177	0.25
178	0.29
179	0.31
180	0.33
181	0.32
182	0.34
183	0.31
184	0.3
185	0.21
186	0.18
187	0.16
188	0.14
189	0.12
190	0.09
191	0.08
192	0.05
193	0.05
194	0.04
195	0.04
196	0.03
197	0.03
198	0.03
199	0.03
200	0.03
201	0.03
202	0.03
203	0.03
204	0.03
205	0.03
206	0.04
207	0.04
208	0.05
209	0.05
210	0.06
211	0.09
212	0.12
213	0.12
214	0.12
215	0.12
216	0.12
217	0.13
218	0.12
219	0.1
220	0.06
221	0.06
222	0.06
223	0.07
224	0.06
225	0.05
226	0.06
227	0.06
228	0.07
229	0.07
230	0.07
231	0.06
232	0.07
233	0.07
234	0.06
235	0.07
236	0.06
237	0.07
238	0.07
239	0.07
240	0.06
241	0.06
242	0.07
243	0.05
244	0.05
245	0.05
246	0.05
247	0.05
248	0.05
249	0.05
250	0.04
251	0.05
252	0.04
253	0.04
254	0.04
255	0.04
256	0.04
257	0.04
258	0.05
259	0.05
260	0.07
261	0.07
262	0.08
263	0.09
264	0.1
265	0.11
266	0.13
267	0.17
268	0.18
269	0.18
270	0.19
271	0.21
272	0.2
273	0.22
274	0.22
275	0.22
276	0.23
277	0.25
278	0.24
279	0.23
280	0.25
281	0.25
282	0.28
283	0.26
284	0.27
285	0.24
286	0.26
287	0.26
288	0.24
289	0.26
290	0.22
291	0.19
292	0.16
293	0.16
294	0.15
295	0.14
296	0.13
297	0.08
298	0.08
299	0.08
300	0.08
301	0.07
302	0.06
303	0.07
304	0.06
305	0.06
306	0.05
307	0.06
308	0.06
309	0.08
310	0.08
311	0.08
312	0.12
313	0.12
314	0.12
315	0.12
316	0.12
317	0.1
318	0.13
319	0.12
320	0.08
321	0.08
322	0.08
323	0.08
324	0.08
325	0.08
326	0.04
327	0.05
328	0.05
329	0.06
330	0.07
331	0.07
332	0.07
333	0.07
334	0.08
335	0.07
336	0.07
337	0.08
338	0.07
339	0.08
340	0.08
341	0.08
342	0.08
343	0.09
344	0.08
345	0.08
346	0.08
347	0.07
348	0.07
349	0.06
350	0.09
351	0.1
352	0.11
353	0.12
354	0.13
355	0.13
356	0.13
357	0.14
358	0.13
359	0.13
360	0.15
361	0.19
362	0.2
363	0.22
364	0.23
365	0.24
366	0.25
367	0.27
368	0.29
369	0.24
370	0.25
371	0.23
372	0.23
373	0.22
374	0.23
375	0.21
376	0.17
377	0.17
378	0.18
379	0.18
380	0.18
381	0.19
382	0.17
383	0.16
384	0.17
385	0.19
386	0.15
387	0.14
388	0.15
389	0.13
390	0.11
391	0.11
392	0.09
393	0.07
394	0.07
395	0.06
396	0.05
397	0.05
398	0.05
399	0.05
400	0.05
401	0.05
402	0.06
403	0.06
404	0.07
405	0.07
406	0.07
407	0.07
408	0.07
409	0.08
410	0.07
411	0.07
412	0.06
413	0.06
414	0.06
415	0.07
416	0.09
417	0.09
418	0.11
419	0.12
420	0.16
421	0.23
422	0.25
423	0.28
424	0.28
425	0.28
426	0.29
427	0.32
428	0.35
429	0.31
430	0.32
431	0.32
432	0.3
433	0.33
434	0.3
435	0.27
436	0.25
437	0.28
438	0.32
439	0.35
440	0.41
441	0.48
442	0.57
443	0.67
444	0.72
445	0.76
446	0.8
447	0.84
448	0.88
449	0.84
450	0.86
451	0.84
452	0.84
453	0.8
454	0.8
455	0.74
456	0.71
457	0.68
458	0.68
459	0.67
460	0.6
461	0.56
462	0.47
463	0.44
464	0.36

A0A4S4KXQ1

3D AlphaFold-predicted Structure Viewer