Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4K7Z5

Protein Details
Accession A0A4S4K7Z5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41VDDSREQSTKDRRRERNRLAAQKHRLRBasic
NLS Segment(s)
PositionSequence
26-42RRRERNRLAAQKHRLRR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences MSSPTSDASDSRDSVDDSREQSTKDRRRERNRLAAQKHRLRRNERMSQLEQQVLALQHDKNQLIAQLDSSSSSLGDAKTNADASGSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.23
4 0.22
5 0.25
6 0.24
7 0.24
8 0.29
9 0.38
10 0.44
11 0.51
12 0.58
13 0.65
14 0.74
15 0.83
16 0.85
17 0.85
18 0.86
19 0.86
20 0.83
21 0.82
22 0.81
23 0.79
24 0.79
25 0.75
26 0.74
27 0.7
28 0.73
29 0.71
30 0.7
31 0.66
32 0.65
33 0.61
34 0.58
35 0.54
36 0.46
37 0.37
38 0.28
39 0.25
40 0.19
41 0.16
42 0.14
43 0.11
44 0.14
45 0.18
46 0.18
47 0.16
48 0.16
49 0.18
50 0.17
51 0.18
52 0.15
53 0.12
54 0.12
55 0.13
56 0.13
57 0.11
58 0.08
59 0.09
60 0.09
61 0.09
62 0.11
63 0.11
64 0.12
65 0.15
66 0.16
67 0.15