Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LKD2

Protein Details
Accession A0A4S4LKD2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-38SARLNAKNFKMKRNPRKVKWTKAFRKAHGKEHydrophilic
NLS Segment(s)
PositionSequence
15-37KNFKMKRNPRKVKWTKAFRKAHG
85-103WKNRMAASRAKLLVHRKKK
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MIQRFSDSARLNAXKNFKMKRNPRKVKWTKAFRKAHGKEMTIDSTIDFEKRRNVPVRYNRELVQTTIKAMKRVGEIRQRREHAFWKNRMAASRAKLLVHRKKKLTALSTVKLVQPMEALSVDSTPVKVKXKSSCAREEKCARTERRAHDGYGDRLIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.58
4 0.61
5 0.68
6 0.76
7 0.8
8 0.85
9 0.83
10 0.91
11 0.91
12 0.91
13 0.9
14 0.91
15 0.89
16 0.89
17 0.89
18 0.85
19 0.87
20 0.79
21 0.78
22 0.73
23 0.64
24 0.57
25 0.54
26 0.49
27 0.38
28 0.35
29 0.25
30 0.21
31 0.19
32 0.18
33 0.14
34 0.12
35 0.18
36 0.21
37 0.27
38 0.32
39 0.35
40 0.43
41 0.52
42 0.6
43 0.58
44 0.58
45 0.53
46 0.51
47 0.48
48 0.4
49 0.36
50 0.28
51 0.24
52 0.28
53 0.28
54 0.24
55 0.23
56 0.23
57 0.21
58 0.24
59 0.28
60 0.31
61 0.37
62 0.43
63 0.5
64 0.5
65 0.49
66 0.49
67 0.5
68 0.5
69 0.52
70 0.5
71 0.49
72 0.51
73 0.5
74 0.48
75 0.44
76 0.39
77 0.33
78 0.34
79 0.29
80 0.25
81 0.29
82 0.37
83 0.44
84 0.49
85 0.53
86 0.5
87 0.54
88 0.58
89 0.6
90 0.53
91 0.53
92 0.51
93 0.46
94 0.46
95 0.44
96 0.39
97 0.35
98 0.32
99 0.23
100 0.16
101 0.14
102 0.12
103 0.11
104 0.1
105 0.08
106 0.08
107 0.09
108 0.09
109 0.09
110 0.12
111 0.14
112 0.16
113 0.2
114 0.21
115 0.3
116 0.4
117 0.47
118 0.51
119 0.59
120 0.61
121 0.67
122 0.75
123 0.72
124 0.69
125 0.71
126 0.68
127 0.66
128 0.71
129 0.68
130 0.68
131 0.64
132 0.58
133 0.57
134 0.59
135 0.55