Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4KZQ7

Protein Details
Accession A0A4S4KZQ7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
341-362PVELKTRLRSSAKKCKRVSKHNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR040976  Pkinase_fungal  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
Amino Acid Sequences MMITPYGKPLESFNCLFELLRKIRDFIETIENLNDKGVLLCDISIWNIALVQINCKDPRSGRRGYITDIDYLDASFYKPRESRSPATGTLPFMALEMMVTENDNTVPHLHYHDLESVLYVLCWICTTQEGPNSTSRSPDFNFSGSDVAEWAGYGKVAPDMESVRSAEGTVKSSANFKERVLKQFAPYFKPLHNCILEKSCKIGKXHNAGLPFPLRLLANIPPSQRDPQDLFKALYRVIDDTLKTLVEPLALSEGTAFVPETRDTDAVESSTQEIAQTKVVDIIDRREAFIEQKKAEGVRRKEPLVVRRSERLAKQRHTASTSATRVGSLAQSSTETKISSSPVELKTRLRSSAKKCKRVSKHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.27
5 0.31
6 0.29
7 0.35
8 0.34
9 0.34
10 0.35
11 0.38
12 0.35
13 0.3
14 0.35
15 0.29
16 0.3
17 0.33
18 0.32
19 0.28
20 0.27
21 0.23
22 0.14
23 0.14
24 0.13
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.1
31 0.1
32 0.09
33 0.08
34 0.08
35 0.09
36 0.13
37 0.13
38 0.16
39 0.18
40 0.23
41 0.25
42 0.26
43 0.29
44 0.29
45 0.38
46 0.4
47 0.43
48 0.43
49 0.5
50 0.51
51 0.52
52 0.53
53 0.46
54 0.42
55 0.38
56 0.33
57 0.25
58 0.22
59 0.18
60 0.12
61 0.11
62 0.12
63 0.11
64 0.17
65 0.19
66 0.24
67 0.31
68 0.38
69 0.41
70 0.44
71 0.49
72 0.45
73 0.47
74 0.46
75 0.4
76 0.33
77 0.29
78 0.23
79 0.17
80 0.15
81 0.1
82 0.07
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.07
91 0.07
92 0.08
93 0.09
94 0.09
95 0.12
96 0.13
97 0.13
98 0.15
99 0.17
100 0.16
101 0.15
102 0.14
103 0.12
104 0.11
105 0.1
106 0.08
107 0.06
108 0.05
109 0.05
110 0.05
111 0.04
112 0.06
113 0.07
114 0.1
115 0.14
116 0.17
117 0.19
118 0.24
119 0.27
120 0.26
121 0.28
122 0.26
123 0.26
124 0.25
125 0.27
126 0.23
127 0.21
128 0.22
129 0.19
130 0.19
131 0.15
132 0.14
133 0.1
134 0.08
135 0.07
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.06
145 0.07
146 0.08
147 0.09
148 0.1
149 0.1
150 0.09
151 0.09
152 0.09
153 0.1
154 0.1
155 0.12
156 0.12
157 0.12
158 0.12
159 0.15
160 0.17
161 0.17
162 0.18
163 0.16
164 0.24
165 0.26
166 0.3
167 0.34
168 0.34
169 0.33
170 0.37
171 0.39
172 0.34
173 0.34
174 0.31
175 0.28
176 0.3
177 0.3
178 0.3
179 0.3
180 0.27
181 0.26
182 0.3
183 0.3
184 0.27
185 0.28
186 0.26
187 0.26
188 0.28
189 0.33
190 0.3
191 0.33
192 0.38
193 0.39
194 0.37
195 0.36
196 0.34
197 0.27
198 0.23
199 0.19
200 0.14
201 0.09
202 0.11
203 0.13
204 0.17
205 0.19
206 0.2
207 0.21
208 0.24
209 0.26
210 0.25
211 0.26
212 0.24
213 0.27
214 0.32
215 0.32
216 0.3
217 0.3
218 0.3
219 0.26
220 0.24
221 0.2
222 0.15
223 0.14
224 0.15
225 0.13
226 0.13
227 0.14
228 0.12
229 0.11
230 0.11
231 0.09
232 0.08
233 0.08
234 0.07
235 0.08
236 0.08
237 0.08
238 0.07
239 0.08
240 0.07
241 0.07
242 0.07
243 0.05
244 0.07
245 0.08
246 0.09
247 0.11
248 0.12
249 0.12
250 0.13
251 0.14
252 0.13
253 0.13
254 0.12
255 0.11
256 0.11
257 0.11
258 0.1
259 0.11
260 0.11
261 0.13
262 0.13
263 0.11
264 0.14
265 0.14
266 0.16
267 0.16
268 0.19
269 0.24
270 0.24
271 0.25
272 0.23
273 0.24
274 0.27
275 0.34
276 0.37
277 0.3
278 0.31
279 0.33
280 0.35
281 0.41
282 0.45
283 0.43
284 0.45
285 0.5
286 0.5
287 0.54
288 0.58
289 0.59
290 0.58
291 0.59
292 0.55
293 0.55
294 0.6
295 0.6
296 0.61
297 0.61
298 0.63
299 0.61
300 0.64
301 0.65
302 0.65
303 0.63
304 0.56
305 0.53
306 0.53
307 0.51
308 0.46
309 0.39
310 0.33
311 0.29
312 0.3
313 0.25
314 0.17
315 0.15
316 0.12
317 0.15
318 0.17
319 0.19
320 0.19
321 0.17
322 0.17
323 0.18
324 0.2
325 0.2
326 0.22
327 0.27
328 0.31
329 0.37
330 0.39
331 0.43
332 0.49
333 0.52
334 0.55
335 0.55
336 0.59
337 0.62
338 0.71
339 0.76
340 0.77
341 0.8
342 0.84