Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4KZT0

Protein Details
Accession A0A4S4KZT0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-117PKAKVDKENAKKPKAKPKKEINVEEEGBasic
NLS Segment(s)
PositionSequence
77-109PKRGQAPAKKEAKVPKAKVDKENAKKPKAKPKK
Subcellular Location(s) nucl 12, cyto_nucl 11.333, cyto 8.5, cyto_mito 8.166, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
Amino Acid Sequences MPRVASEKTTKTARKAAATASGDGKRIFSPKAKRQPSAYNMFVGIHLKEWKRDHPGIPIKEGMVAVAELWRDAAENPKRGQAPAKKEAKVPKAKVDKENAKKPKAKPKKEINVEEEGGDAGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.46
4 0.47
5 0.44
6 0.41
7 0.39
8 0.36
9 0.33
10 0.31
11 0.3
12 0.23
13 0.23
14 0.23
15 0.25
16 0.33
17 0.41
18 0.52
19 0.56
20 0.57
21 0.6
22 0.67
23 0.66
24 0.63
25 0.55
26 0.45
27 0.4
28 0.37
29 0.32
30 0.25
31 0.18
32 0.13
33 0.16
34 0.16
35 0.2
36 0.22
37 0.25
38 0.31
39 0.33
40 0.32
41 0.37
42 0.45
43 0.41
44 0.41
45 0.38
46 0.31
47 0.29
48 0.27
49 0.18
50 0.09
51 0.07
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.13
61 0.17
62 0.21
63 0.23
64 0.27
65 0.28
66 0.28
67 0.36
68 0.35
69 0.39
70 0.44
71 0.5
72 0.47
73 0.52
74 0.6
75 0.61
76 0.64
77 0.59
78 0.59
79 0.62
80 0.66
81 0.67
82 0.69
83 0.7
84 0.7
85 0.77
86 0.76
87 0.74
88 0.77
89 0.78
90 0.8
91 0.8
92 0.81
93 0.8
94 0.83
95 0.85
96 0.88
97 0.89
98 0.83
99 0.8
100 0.71
101 0.61
102 0.5
103 0.39