Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3XC35

Protein Details
Accession A0A4V3XC35   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
313-332SSSRHKLFTKRDKQIAQARKHydrophilic
NLS Segment(s)
PositionSequence
315-340SRHKLFTKRDKQIAQARKDARKEAAS
Subcellular Location(s) nucl 14, cyto 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR032438  ERCC3_RAD25_C  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR001161  XPB/Ssl2  
Gene Ontology GO:0003678  F:DNA helicase activity  
GO:0006289  P:nucleotide-excision repair  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF16203  ERCC3_RAD25_C  
PROSITE View protein in PROSITE  
PS51194  HELICASE_CTER  
CDD cd18789  SF2_C_XPB  
Amino Acid Sequences MIGPKLYEANWMDLAAKGHIANVQCAEVWCPMTPEFYREYLREQSRKRMLLYCMNPNKIQACQFLIKYHEDRGDKIIVFSDNVYALEHYARKLGKLYIHGGTSQVERMRVLQHFQHHPKVNTIFLSKVGDTSIDLPEATCLIQISSHFGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMFYSTKRQQFLIDQGYAFKVITHLDGLQTLPDLAYRMQDEQIELISSVLLANESDAELGNDVRAGEGDLPGTITAKDFGGPGQRAGSMPAAKRTTGSLGALSGAAHMSYVEQNKSANKKLAKESAGSSSRHKLFTKRDKQIAQARKDARKEAASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.19
3 0.19
4 0.14
5 0.14
6 0.17
7 0.17
8 0.17
9 0.17
10 0.17
11 0.16
12 0.17
13 0.18
14 0.18
15 0.19
16 0.16
17 0.18
18 0.17
19 0.21
20 0.21
21 0.22
22 0.23
23 0.25
24 0.29
25 0.27
26 0.33
27 0.37
28 0.45
29 0.51
30 0.52
31 0.58
32 0.63
33 0.65
34 0.63
35 0.6
36 0.57
37 0.58
38 0.59
39 0.6
40 0.59
41 0.6
42 0.57
43 0.54
44 0.5
45 0.44
46 0.42
47 0.34
48 0.31
49 0.31
50 0.31
51 0.31
52 0.32
53 0.35
54 0.33
55 0.35
56 0.37
57 0.34
58 0.34
59 0.35
60 0.37
61 0.31
62 0.29
63 0.28
64 0.22
65 0.21
66 0.19
67 0.17
68 0.12
69 0.12
70 0.12
71 0.1
72 0.09
73 0.12
74 0.12
75 0.11
76 0.15
77 0.15
78 0.15
79 0.17
80 0.19
81 0.2
82 0.22
83 0.26
84 0.24
85 0.25
86 0.24
87 0.23
88 0.21
89 0.19
90 0.19
91 0.17
92 0.15
93 0.14
94 0.15
95 0.19
96 0.19
97 0.2
98 0.2
99 0.25
100 0.34
101 0.38
102 0.45
103 0.47
104 0.47
105 0.5
106 0.48
107 0.44
108 0.37
109 0.34
110 0.26
111 0.22
112 0.24
113 0.17
114 0.16
115 0.14
116 0.12
117 0.11
118 0.12
119 0.11
120 0.09
121 0.08
122 0.08
123 0.08
124 0.08
125 0.07
126 0.05
127 0.05
128 0.04
129 0.05
130 0.05
131 0.1
132 0.1
133 0.13
134 0.13
135 0.16
136 0.18
137 0.2
138 0.28
139 0.26
140 0.3
141 0.32
142 0.37
143 0.41
144 0.42
145 0.4
146 0.37
147 0.4
148 0.4
149 0.45
150 0.47
151 0.45
152 0.46
153 0.53
154 0.53
155 0.5
156 0.5
157 0.45
158 0.38
159 0.35
160 0.32
161 0.25
162 0.2
163 0.17
164 0.13
165 0.09
166 0.08
167 0.08
168 0.07
169 0.09
170 0.1
171 0.11
172 0.11
173 0.12
174 0.13
175 0.15
176 0.2
177 0.22
178 0.25
179 0.26
180 0.25
181 0.26
182 0.26
183 0.3
184 0.3
185 0.27
186 0.22
187 0.22
188 0.22
189 0.21
190 0.18
191 0.12
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.08
199 0.08
200 0.07
201 0.07
202 0.06
203 0.05
204 0.05
205 0.06
206 0.06
207 0.07
208 0.08
209 0.1
210 0.11
211 0.11
212 0.11
213 0.11
214 0.11
215 0.1
216 0.09
217 0.07
218 0.06
219 0.05
220 0.05
221 0.04
222 0.04
223 0.03
224 0.03
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.07
243 0.07
244 0.07
245 0.06
246 0.06
247 0.07
248 0.07
249 0.07
250 0.07
251 0.09
252 0.16
253 0.16
254 0.17
255 0.17
256 0.18
257 0.18
258 0.2
259 0.24
260 0.21
261 0.22
262 0.29
263 0.29
264 0.28
265 0.29
266 0.29
267 0.27
268 0.25
269 0.24
270 0.17
271 0.15
272 0.16
273 0.15
274 0.13
275 0.1
276 0.08
277 0.06
278 0.06
279 0.05
280 0.06
281 0.11
282 0.15
283 0.15
284 0.16
285 0.19
286 0.26
287 0.33
288 0.37
289 0.4
290 0.42
291 0.47
292 0.54
293 0.6
294 0.55
295 0.52
296 0.49
297 0.5
298 0.5
299 0.46
300 0.44
301 0.45
302 0.46
303 0.49
304 0.48
305 0.47
306 0.53
307 0.62
308 0.68
309 0.68
310 0.73
311 0.72
312 0.78
313 0.8
314 0.79
315 0.75
316 0.74
317 0.73
318 0.73
319 0.74
320 0.71
321 0.67