FuNGI

A0A4S4LKW2

Protein Details

Accession

A0A4S4LKW2

Localization Confidence

High

Confidence Score

16.8

NoLS Segment(s)

Position	Sequence	Protein Nature
60-84	ARDAAADRKRIKKRGPTRSIRLFGL	Hydrophilic
165-197	EEQRRREEREDKEERRRRRRERRELKRISQTLA	Basic

NLS Segment(s)

Position	Sequence
67-76	RKRIKKXRGP
169-214	RRREEREDKEERRRRRRERRELKRISQTLAKNGGRNRRFGGIRRIP

Subcellular Location(s)

nucl 13, cyto 8, extr 3, mito 1, pero 1, cysk 1

Family & Domain DBs

InterPro	View protein in InterPro IPR003958 CBFA_NFYB_domain IPR009072 Histone-fold IPR027113 Transc_fact_NFYB/HAP3
Gene Ontology	GO:0016602 C:CCAAT-binding factor complex GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0046982 F:protein heterodimerization activity
Pfam	View protein in Pfam PF00808 CBFD_NFYB_HMF

Amino Acid Sequences

MDDFSWTDGVRAAVSACLPCFTSNERGSPSDDSVQSENEVRVSRPSQTHYDELEGLLGDARDAAADRKRIKKXRGPTRSIRLFGLNLFGRPPIQLSDSEHDDEVSDRGDVAAQRSRLGRLSSAHSSSSVSAFDSDASPLDAAVIAQLTAQDAAARAEHEATLHAAEEQRRREEREDKEERRRRRRERRELKRISQTLAKNGGRNRRFGGIRRIPRESAMTSPGISTAHVEFGPFVEGTRPSRSGNELADGEADFGGEAYTRKALSRRSDSSRSHTHSQTSASHSQSHTNSNSSSSRYHYFSQGSPLPPHSTLSPGAGFQAVNIANMPASSNGPLNLTEVSHKKRSKNSSASQSIGRKSTISPTSTSASLPSVDPASPVRATFAPVEPYIVEHDSESGAGALPVSPGVSAFTFGGALQNEGKFPSTGLGGVRRTNSSGSGVFLARRDIYPDIFVYTALELSQSSPRNARKAYPETMSETAKANIAPGPTADGASVVDTPDEVPEAQAISDHEVGEYREQDRFLPIANVARIMKASVPPTAKIAKDAKECVQECVSEFISFITSEAAEKCQLEKRKTIGGEDILYAMISLGFENYAETLKIHLAKLRQHQTSAAASRAAEAGDGEDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.14
3	0.13
4	0.13
5	0.14
6	0.15
7	0.17
8	0.21
9	0.28
10	0.29
11	0.34
12	0.37
13	0.38
14	0.41
15	0.42
16	0.42
17	0.4
18	0.38
19	0.37
20	0.35
21	0.34
22	0.32
23	0.31
24	0.27
25	0.24
26	0.24
27	0.21
28	0.25
29	0.26
30	0.3
31	0.32
32	0.36
33	0.39
34	0.43
35	0.47
36	0.43
37	0.45
38	0.4
39	0.35
40	0.31
41	0.24
42	0.19
43	0.16
44	0.12
45	0.08
46	0.07
47	0.07
48	0.06
49	0.07
50	0.11
51	0.15
52	0.22
53	0.29
54	0.39
55	0.49
56	0.57
57	0.65
58	0.72
59	0.77
60	0.81
61	0.85
62	0.85
63	0.86
64	0.88
65	0.84
66	0.75
67	0.69
68	0.59
69	0.49
70	0.47
71	0.38
72	0.29
73	0.25
74	0.23
75	0.2
76	0.19
77	0.19
78	0.14
79	0.15
80	0.16
81	0.21
82	0.25
83	0.29
84	0.31
85	0.29
86	0.27
87	0.25
88	0.24
89	0.19
90	0.14
91	0.1
92	0.08
93	0.08
94	0.1
95	0.11
96	0.14
97	0.19
98	0.18
99	0.21
100	0.23
101	0.25
102	0.26
103	0.27
104	0.26
105	0.23
106	0.29
107	0.32
108	0.32
109	0.31
110	0.28
111	0.28
112	0.26
113	0.25
114	0.19
115	0.14
116	0.12
117	0.12
118	0.12
119	0.11
120	0.1
121	0.09
122	0.1
123	0.09
124	0.08
125	0.08
126	0.07
127	0.06
128	0.06
129	0.05
130	0.04
131	0.04
132	0.04
133	0.05
134	0.05
135	0.05
136	0.05
137	0.05
138	0.06
139	0.07
140	0.07
141	0.07
142	0.08
143	0.08
144	0.08
145	0.08
146	0.08
147	0.08
148	0.08
149	0.09
150	0.11
151	0.16
152	0.21
153	0.24
154	0.31
155	0.33
156	0.37
157	0.43
158	0.49
159	0.51
160	0.56
161	0.62
162	0.63
163	0.72
164	0.76
165	0.81
166	0.83
167	0.86
168	0.87
169	0.88
170	0.91
171	0.91
172	0.94
173	0.95
174	0.95
175	0.94
176	0.91
177	0.9
178	0.81
179	0.73
180	0.7
181	0.61
182	0.56
183	0.56
184	0.5
185	0.44
186	0.47
187	0.53
188	0.48
189	0.48
190	0.43
191	0.41
192	0.42
193	0.42
194	0.48
195	0.47
196	0.54
197	0.56
198	0.58
199	0.52
200	0.51
201	0.5
202	0.4
203	0.33
204	0.28
205	0.24
206	0.2
207	0.19
208	0.18
209	0.14
210	0.13
211	0.11
212	0.09
213	0.09
214	0.09
215	0.09
216	0.08
217	0.08
218	0.1
219	0.08
220	0.07
221	0.08
222	0.1
223	0.13
224	0.16
225	0.18
226	0.17
227	0.19
228	0.22
229	0.23
230	0.21
231	0.22
232	0.18
233	0.17
234	0.16
235	0.15
236	0.13
237	0.09
238	0.08
239	0.05
240	0.05
241	0.04
242	0.04
243	0.04
244	0.04
245	0.06
246	0.06
247	0.07
248	0.1
249	0.16
250	0.22
251	0.29
252	0.34
253	0.4
254	0.47
255	0.49
256	0.53
257	0.56
258	0.55
259	0.53
260	0.49
261	0.45
262	0.38
263	0.39
264	0.36
265	0.34
266	0.33
267	0.29
268	0.31
269	0.29
270	0.33
271	0.31
272	0.32
273	0.28
274	0.24
275	0.23
276	0.23
277	0.24
278	0.22
279	0.21
280	0.2
281	0.22
282	0.23
283	0.24
284	0.24
285	0.24
286	0.22
287	0.26
288	0.27
289	0.26
290	0.24
291	0.25
292	0.24
293	0.22
294	0.22
295	0.17
296	0.16
297	0.14
298	0.14
299	0.13
300	0.1
301	0.1
302	0.1
303	0.1
304	0.07
305	0.11
306	0.09
307	0.09
308	0.08
309	0.08
310	0.07
311	0.07
312	0.08
313	0.04
314	0.05
315	0.06
316	0.06
317	0.06
318	0.07
319	0.08
320	0.08
321	0.08
322	0.08
323	0.1
324	0.15
325	0.19
326	0.26
327	0.3
328	0.33
329	0.41
330	0.48
331	0.54
332	0.58
333	0.6
334	0.61
335	0.62
336	0.59
337	0.58
338	0.55
339	0.48
340	0.41
341	0.35
342	0.26
343	0.23
344	0.27
345	0.25
346	0.22
347	0.21
348	0.23
349	0.24
350	0.24
351	0.23
352	0.17
353	0.14
354	0.14
355	0.12
356	0.1
357	0.1
358	0.09
359	0.1
360	0.1
361	0.12
362	0.12
363	0.11
364	0.13
365	0.12
366	0.14
367	0.15
368	0.15
369	0.15
370	0.14
371	0.16
372	0.13
373	0.14
374	0.14
375	0.13
376	0.12
377	0.09
378	0.1
379	0.09
380	0.09
381	0.08
382	0.06
383	0.05
384	0.04
385	0.04
386	0.04
387	0.04
388	0.04
389	0.04
390	0.03
391	0.03
392	0.05
393	0.05
394	0.06
395	0.06
396	0.06
397	0.06
398	0.06
399	0.09
400	0.08
401	0.09
402	0.1
403	0.1
404	0.11
405	0.11
406	0.12
407	0.09
408	0.09
409	0.09
410	0.08
411	0.08
412	0.1
413	0.14
414	0.16
415	0.18
416	0.2
417	0.2
418	0.21
419	0.21
420	0.2
421	0.18
422	0.17
423	0.15
424	0.16
425	0.15
426	0.15
427	0.15
428	0.16
429	0.14
430	0.14
431	0.15
432	0.15
433	0.15
434	0.16
435	0.16
436	0.15
437	0.14
438	0.14
439	0.12
440	0.1
441	0.1
442	0.08
443	0.07
444	0.06
445	0.08
446	0.14
447	0.15
448	0.17
449	0.23
450	0.27
451	0.33
452	0.35
453	0.37
454	0.39
455	0.44
456	0.47
457	0.43
458	0.42
459	0.42
460	0.44
461	0.42
462	0.34
463	0.3
464	0.26
465	0.24
466	0.21
467	0.16
468	0.15
469	0.13
470	0.12
471	0.1
472	0.13
473	0.12
474	0.13
475	0.11
476	0.1
477	0.1
478	0.11
479	0.11
480	0.07
481	0.07
482	0.07
483	0.07
484	0.07
485	0.08
486	0.07
487	0.06
488	0.07
489	0.08
490	0.07
491	0.08
492	0.09
493	0.12
494	0.13
495	0.13
496	0.13
497	0.13
498	0.15
499	0.17
500	0.19
501	0.16
502	0.17
503	0.18
504	0.19
505	0.2
506	0.2
507	0.18
508	0.17
509	0.17
510	0.21
511	0.21
512	0.24
513	0.21
514	0.22
515	0.2
516	0.19
517	0.2
518	0.18
519	0.19
520	0.22
521	0.24
522	0.24
523	0.28
524	0.32
525	0.3
526	0.33
527	0.37
528	0.38
529	0.41
530	0.45
531	0.46
532	0.5
533	0.51
534	0.49
535	0.45
536	0.39
537	0.35
538	0.35
539	0.31
540	0.22
541	0.21
542	0.17
543	0.16
544	0.15
545	0.14
546	0.1
547	0.09
548	0.1
549	0.12
550	0.13
551	0.14
552	0.15
553	0.18
554	0.25
555	0.33
556	0.36
557	0.41
558	0.43
559	0.49
560	0.5
561	0.5
562	0.48
563	0.44
564	0.42
565	0.36
566	0.33
567	0.25
568	0.22
569	0.19
570	0.12
571	0.08
572	0.06
573	0.05
574	0.05
575	0.05
576	0.05
577	0.06
578	0.07
579	0.08
580	0.08
581	0.09
582	0.1
583	0.15
584	0.18
585	0.19
586	0.22
587	0.26
588	0.33
589	0.43
590	0.51
591	0.5
592	0.48
593	0.49
594	0.5
595	0.54
596	0.5
597	0.42
598	0.35
599	0.31
600	0.31
601	0.3
602	0.24
603	0.16
604	0.12

A0A4S4LKW2

3D AlphaFold-predicted Structure Viewer