Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4K8A0

Protein Details
Accession A0A4S4K8A0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-117DAEPGGKKKRKRRVVAEKKAKDPNABasic
NLS Segment(s)
PositionSequence
97-124GGKKKRKRRVVAEKKAKDPNAPKRPPXR
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MDMDIAAAVIPLARSPPPPPPPPTLVTALSQAAESLRQAASMADNYAAVLAQQHPSAGLNLNLNPMSMFQLFSPQGAPAHPAAAAAAADTDADAEPGGKKKRKRRVVAEKKAKDPNAPKRPPXRPYHELLSKISERWSQMNDTEKKVYNDLTNMSKIEWQEKKAIYDAQLTGTNGAATSPETPTLMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.23
4 0.3
5 0.37
6 0.41
7 0.46
8 0.5
9 0.5
10 0.52
11 0.47
12 0.41
13 0.36
14 0.34
15 0.28
16 0.24
17 0.21
18 0.17
19 0.13
20 0.11
21 0.1
22 0.09
23 0.08
24 0.08
25 0.08
26 0.09
27 0.1
28 0.1
29 0.11
30 0.09
31 0.09
32 0.08
33 0.08
34 0.07
35 0.05
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.08
42 0.08
43 0.1
44 0.09
45 0.1
46 0.1
47 0.11
48 0.13
49 0.13
50 0.12
51 0.11
52 0.11
53 0.12
54 0.1
55 0.1
56 0.08
57 0.13
58 0.13
59 0.14
60 0.14
61 0.11
62 0.11
63 0.11
64 0.13
65 0.08
66 0.08
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.09
84 0.15
85 0.2
86 0.26
87 0.36
88 0.46
89 0.56
90 0.63
91 0.69
92 0.75
93 0.82
94 0.86
95 0.88
96 0.84
97 0.81
98 0.8
99 0.71
100 0.66
101 0.64
102 0.64
103 0.63
104 0.66
105 0.66
106 0.69
107 0.78
108 0.78
109 0.75
110 0.73
111 0.66
112 0.66
113 0.66
114 0.61
115 0.54
116 0.53
117 0.48
118 0.4
119 0.39
120 0.33
121 0.28
122 0.26
123 0.26
124 0.23
125 0.26
126 0.35
127 0.35
128 0.37
129 0.4
130 0.41
131 0.4
132 0.4
133 0.38
134 0.31
135 0.3
136 0.29
137 0.29
138 0.27
139 0.26
140 0.24
141 0.25
142 0.24
143 0.3
144 0.31
145 0.29
146 0.34
147 0.36
148 0.38
149 0.38
150 0.4
151 0.33
152 0.35
153 0.33
154 0.29
155 0.3
156 0.28
157 0.26
158 0.23
159 0.21
160 0.15
161 0.14
162 0.11
163 0.09
164 0.1
165 0.11
166 0.12