Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PSF7

Protein Details
Accession A0A5C3PSF7    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGRSAKFHKRPKKTTSSAGSHydrophilic
NLS Segment(s)
PositionSequence
7-15FHKRPKKTT
24-57PQPAPKAKAPSAAPAIREQKKRAGLKAKTSKHKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGRSAKFHKRPKKTTSSAGSSSVPQPAPKAKAPSAAPAIREQKKRAGLKAKTSKHKREGDGPVLGGADYVELMFGSRRRAAAEAAKLPKDPDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.68
5 0.63
6 0.55
7 0.47
8 0.42
9 0.38
10 0.3
11 0.23
12 0.23
13 0.25
14 0.28
15 0.3
16 0.34
17 0.3
18 0.35
19 0.36
20 0.38
21 0.38
22 0.36
23 0.33
24 0.33
25 0.4
26 0.4
27 0.43
28 0.4
29 0.4
30 0.47
31 0.48
32 0.47
33 0.49
34 0.46
35 0.53
36 0.6
37 0.61
38 0.64
39 0.7
40 0.72
41 0.72
42 0.75
43 0.67
44 0.66
45 0.66
46 0.61
47 0.55
48 0.47
49 0.38
50 0.32
51 0.28
52 0.19
53 0.12
54 0.07
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.06
61 0.07
62 0.11
63 0.13
64 0.14
65 0.16
66 0.18
67 0.21
68 0.26
69 0.33
70 0.37
71 0.42
72 0.44
73 0.43