Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P798

Protein Details
Accession A0A5C3P798    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-74SNVPAQPPKGKSKKKNTIRHPKNTAELHydrophilic
188-218QATTVPQPTREKKPKSQKKRTPVARLPPLFEHydrophilic
NLS Segment(s)
PositionSequence
55-66PKGKSKKKNTIR
197-211REKKPKSQKKRTPVA
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MAKKDKNQGPVANLNSVANRDIIQRINFLYQASTYLSTISSPAASSSSNVPAQPPKGKSKKKNTIRHPKNTAELSRCYVGSMRIVGQKAMVRMDPSIKRTLCKQCDTILIPGSTASVRVKPLSSHGHAVVYTCTSCNATRRIPAPPVLDPEALPQESSSSAVGAVVPSTSVTAPTTAGADSDAMNVDQATTVPQPTREKKPKSQKKRTPVARLPPLFERKGHLVFRGNEILAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.33
4 0.27
5 0.19
6 0.17
7 0.16
8 0.19
9 0.22
10 0.22
11 0.22
12 0.24
13 0.25
14 0.25
15 0.23
16 0.21
17 0.16
18 0.17
19 0.17
20 0.16
21 0.14
22 0.13
23 0.13
24 0.12
25 0.12
26 0.11
27 0.09
28 0.08
29 0.08
30 0.09
31 0.09
32 0.1
33 0.12
34 0.16
35 0.17
36 0.17
37 0.19
38 0.23
39 0.27
40 0.33
41 0.35
42 0.41
43 0.5
44 0.59
45 0.67
46 0.73
47 0.79
48 0.82
49 0.88
50 0.89
51 0.9
52 0.9
53 0.9
54 0.87
55 0.8
56 0.76
57 0.73
58 0.67
59 0.6
60 0.53
61 0.47
62 0.4
63 0.36
64 0.3
65 0.24
66 0.2
67 0.17
68 0.15
69 0.13
70 0.16
71 0.16
72 0.15
73 0.17
74 0.17
75 0.17
76 0.17
77 0.15
78 0.12
79 0.13
80 0.19
81 0.2
82 0.21
83 0.26
84 0.26
85 0.26
86 0.32
87 0.41
88 0.4
89 0.41
90 0.39
91 0.35
92 0.39
93 0.4
94 0.36
95 0.29
96 0.23
97 0.2
98 0.18
99 0.17
100 0.12
101 0.11
102 0.09
103 0.07
104 0.08
105 0.09
106 0.1
107 0.09
108 0.14
109 0.18
110 0.19
111 0.2
112 0.2
113 0.2
114 0.19
115 0.2
116 0.16
117 0.12
118 0.1
119 0.08
120 0.08
121 0.09
122 0.1
123 0.13
124 0.16
125 0.17
126 0.2
127 0.22
128 0.26
129 0.26
130 0.3
131 0.3
132 0.28
133 0.3
134 0.3
135 0.28
136 0.25
137 0.25
138 0.24
139 0.21
140 0.19
141 0.14
142 0.12
143 0.12
144 0.13
145 0.1
146 0.07
147 0.06
148 0.06
149 0.07
150 0.06
151 0.05
152 0.04
153 0.04
154 0.04
155 0.05
156 0.05
157 0.06
158 0.06
159 0.07
160 0.07
161 0.08
162 0.08
163 0.07
164 0.08
165 0.07
166 0.07
167 0.07
168 0.07
169 0.08
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.06
176 0.08
177 0.08
178 0.1
179 0.12
180 0.17
181 0.26
182 0.32
183 0.43
184 0.5
185 0.57
186 0.66
187 0.76
188 0.82
189 0.85
190 0.9
191 0.89
192 0.9
193 0.93
194 0.93
195 0.92
196 0.91
197 0.9
198 0.89
199 0.82
200 0.77
201 0.75
202 0.72
203 0.64
204 0.56
205 0.51
206 0.47
207 0.51
208 0.49
209 0.45
210 0.45
211 0.45
212 0.5
213 0.49