Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NX63

Protein Details
Accession A0A5C3NX63    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22EEYEKKKKKRSTQRMNEARAEMHydrophilic
NLS Segment(s)
PositionSequence
5-10KKKKKR
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
Amino Acid Sequences EEYEKKKKKRSTQRMNEARAEMIMQVDDGQLSHMRSRDPMEIWETLAKVHKARGFATQLAMKRQFLTSKKKPTQSMQAWIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.83
4 0.73
5 0.63
6 0.51
7 0.41
8 0.3
9 0.2
10 0.14
11 0.08
12 0.07
13 0.06
14 0.06
15 0.05
16 0.06
17 0.07
18 0.08
19 0.1
20 0.1
21 0.11
22 0.12
23 0.15
24 0.16
25 0.15
26 0.16
27 0.17
28 0.16
29 0.17
30 0.17
31 0.14
32 0.12
33 0.15
34 0.14
35 0.12
36 0.16
37 0.17
38 0.18
39 0.19
40 0.24
41 0.25
42 0.24
43 0.27
44 0.28
45 0.28
46 0.33
47 0.35
48 0.3
49 0.28
50 0.29
51 0.33
52 0.35
53 0.43
54 0.45
55 0.54
56 0.61
57 0.67
58 0.71
59 0.71
60 0.76
61 0.72