Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NUC3

Protein Details
Accession A0A5C3NUC3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-70HVWTWKGWKGPRKVRRHRKILRDNIQGIHydrophilic
NLS Segment(s)
PositionSequence
49-86GWKGPRKVRRHRKILRDNIQGITKPAIRRLARRGGVKR
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
CDD cd00076  H4  
Amino Acid Sequences MLASIRAQRAPPRLRHVLDCNGHLRSVDPPHLPPNPTQLILNHVWTWKGWKGPRKVRRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVRRLFVTYTEHAKRKTVTALDVVYALKRSGRTLYGFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.63
4 0.63
5 0.58
6 0.56
7 0.52
8 0.45
9 0.42
10 0.35
11 0.3
12 0.26
13 0.27
14 0.28
15 0.26
16 0.27
17 0.33
18 0.37
19 0.37
20 0.33
21 0.36
22 0.33
23 0.32
24 0.3
25 0.25
26 0.26
27 0.26
28 0.27
29 0.21
30 0.19
31 0.18
32 0.17
33 0.21
34 0.18
35 0.23
36 0.26
37 0.32
38 0.41
39 0.51
40 0.61
41 0.67
42 0.76
43 0.81
44 0.85
45 0.88
46 0.87
47 0.88
48 0.89
49 0.88
50 0.86
51 0.82
52 0.75
53 0.66
54 0.6
55 0.5
56 0.4
57 0.32
58 0.26
59 0.19
60 0.19
61 0.24
62 0.23
63 0.27
64 0.32
65 0.38
66 0.4
67 0.47
68 0.48
69 0.49
70 0.52
71 0.49
72 0.44
73 0.38
74 0.34
75 0.27
76 0.24
77 0.18
78 0.15
79 0.15
80 0.14
81 0.12
82 0.12
83 0.11
84 0.1
85 0.08
86 0.07
87 0.08
88 0.1
89 0.14
90 0.18
91 0.21
92 0.21
93 0.23
94 0.22
95 0.22
96 0.2
97 0.18
98 0.2
99 0.2
100 0.27
101 0.32
102 0.37
103 0.38
104 0.4
105 0.4
106 0.37
107 0.4
108 0.35
109 0.31
110 0.31
111 0.3
112 0.28
113 0.28
114 0.25
115 0.2
116 0.19
117 0.16
118 0.14
119 0.14
120 0.16
121 0.18
122 0.21
123 0.23