Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NW34

Protein Details
Accession A0A5C3NW34    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-24EMLPLPPRGKRQRKDSVHGPGRBasic
NLS Segment(s)
PositionSequence
10-17RGKRQRKD
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF13604  AAA_30  
Amino Acid Sequences MPEMLPLPPRGKRQRKDSVHGPGRALKAARMSSPVPLPSATQADKERLHQLGYYSLHQAQRQAFSYAVNKRQSIALLGPAGSGKSYLLRTICKALQTVSGGQEEDVAITALTGSAAANLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.81
4 0.8
5 0.8
6 0.78
7 0.74
8 0.67
9 0.62
10 0.57
11 0.52
12 0.44
13 0.34
14 0.32
15 0.3
16 0.27
17 0.25
18 0.24
19 0.23
20 0.25
21 0.24
22 0.19
23 0.18
24 0.18
25 0.17
26 0.2
27 0.18
28 0.19
29 0.2
30 0.23
31 0.24
32 0.26
33 0.27
34 0.24
35 0.24
36 0.2
37 0.19
38 0.2
39 0.21
40 0.2
41 0.18
42 0.21
43 0.22
44 0.21
45 0.24
46 0.2
47 0.2
48 0.21
49 0.2
50 0.17
51 0.16
52 0.22
53 0.23
54 0.29
55 0.29
56 0.27
57 0.27
58 0.27
59 0.26
60 0.22
61 0.18
62 0.14
63 0.12
64 0.12
65 0.11
66 0.11
67 0.1
68 0.08
69 0.08
70 0.05
71 0.07
72 0.08
73 0.11
74 0.13
75 0.15
76 0.17
77 0.22
78 0.23
79 0.22
80 0.23
81 0.21
82 0.23
83 0.24
84 0.24
85 0.21
86 0.21
87 0.2
88 0.19
89 0.19
90 0.15
91 0.12
92 0.1
93 0.08
94 0.06
95 0.06
96 0.06
97 0.04
98 0.04
99 0.04
100 0.04