Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PHP9

Protein Details
Accession A0A5C3PHP9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-89VEDNDASRKKKRRRKAEGDGQKDTGBasic
226-252VTAREPQETAKRKRRRGKARDEPAIQAHydrophilic
NLS Segment(s)
PositionSequence
72-80RKKKRRRKA
235-245AKRKRRRGKAR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MIPKYSNPSLLLNSTTIVSRAALNEDLEDEEQLPVETQDPEHAQLVARLENILKRTFQEVSPTHVEDNDASRKKKRRRKAEGDGQKDTGQGDAVTEEVAVPFRLLSGVSQPKPIVLAPKAPPKIISYAPAAEDTAAEAERRAARAREVAVDFAWVVAESKKPSISASTSYKKVVRLVAQVPDTNAPLLVLERPRSPPKPPRVARIHPEIEVKPSPHEHKASCCPAVTAREPQETAKRKRRRGKARDEPAIQAMFWRPPPISGKALGYAWGYAGSRPWLSDGKPPRYERDTLKKAEYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.17
4 0.14
5 0.12
6 0.11
7 0.12
8 0.15
9 0.16
10 0.15
11 0.15
12 0.16
13 0.18
14 0.17
15 0.16
16 0.13
17 0.12
18 0.12
19 0.11
20 0.1
21 0.08
22 0.09
23 0.09
24 0.09
25 0.13
26 0.15
27 0.17
28 0.18
29 0.18
30 0.16
31 0.18
32 0.2
33 0.17
34 0.15
35 0.14
36 0.15
37 0.17
38 0.2
39 0.19
40 0.18
41 0.18
42 0.21
43 0.22
44 0.22
45 0.27
46 0.26
47 0.31
48 0.35
49 0.35
50 0.31
51 0.3
52 0.3
53 0.23
54 0.27
55 0.3
56 0.31
57 0.33
58 0.41
59 0.5
60 0.59
61 0.68
62 0.72
63 0.74
64 0.79
65 0.86
66 0.89
67 0.9
68 0.9
69 0.89
70 0.83
71 0.75
72 0.65
73 0.55
74 0.44
75 0.33
76 0.23
77 0.14
78 0.1
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.12
94 0.19
95 0.2
96 0.22
97 0.22
98 0.22
99 0.23
100 0.23
101 0.21
102 0.15
103 0.2
104 0.22
105 0.31
106 0.32
107 0.31
108 0.32
109 0.28
110 0.31
111 0.25
112 0.24
113 0.17
114 0.17
115 0.18
116 0.17
117 0.16
118 0.12
119 0.11
120 0.09
121 0.07
122 0.06
123 0.05
124 0.05
125 0.07
126 0.08
127 0.09
128 0.1
129 0.1
130 0.11
131 0.13
132 0.14
133 0.15
134 0.15
135 0.15
136 0.13
137 0.13
138 0.12
139 0.09
140 0.09
141 0.05
142 0.05
143 0.05
144 0.06
145 0.07
146 0.08
147 0.08
148 0.09
149 0.09
150 0.11
151 0.12
152 0.15
153 0.22
154 0.25
155 0.27
156 0.29
157 0.31
158 0.3
159 0.3
160 0.29
161 0.25
162 0.25
163 0.26
164 0.28
165 0.28
166 0.27
167 0.26
168 0.24
169 0.22
170 0.17
171 0.14
172 0.09
173 0.07
174 0.07
175 0.09
176 0.1
177 0.12
178 0.14
179 0.19
180 0.25
181 0.27
182 0.34
183 0.41
184 0.48
185 0.57
186 0.58
187 0.62
188 0.65
189 0.69
190 0.68
191 0.67
192 0.6
193 0.52
194 0.54
195 0.46
196 0.42
197 0.39
198 0.35
199 0.29
200 0.31
201 0.33
202 0.33
203 0.37
204 0.33
205 0.36
206 0.44
207 0.46
208 0.43
209 0.39
210 0.35
211 0.34
212 0.38
213 0.35
214 0.34
215 0.33
216 0.35
217 0.36
218 0.38
219 0.44
220 0.49
221 0.55
222 0.58
223 0.63
224 0.69
225 0.78
226 0.85
227 0.87
228 0.88
229 0.89
230 0.9
231 0.91
232 0.9
233 0.84
234 0.77
235 0.71
236 0.61
237 0.49
238 0.41
239 0.33
240 0.28
241 0.25
242 0.24
243 0.19
244 0.22
245 0.27
246 0.29
247 0.3
248 0.28
249 0.3
250 0.3
251 0.3
252 0.28
253 0.24
254 0.19
255 0.17
256 0.16
257 0.14
258 0.12
259 0.14
260 0.15
261 0.15
262 0.15
263 0.18
264 0.2
265 0.21
266 0.3
267 0.38
268 0.44
269 0.52
270 0.55
271 0.59
272 0.61
273 0.64
274 0.65
275 0.66
276 0.65
277 0.62