Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PR30

Protein Details
Accession A0A5C3PR30    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-48RSSANTHSSRRHRKPKPAPLRTDPHydrophilic
NLS Segment(s)
PositionSequence
33-42SRRHRKPKPA
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MDASASHAVPAPSSSASRRPPSSSRSSANTHSSRRHRKPKPAPLRTDPTPPPSVPEPAPQSLSSPSSHSPPPASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.28
4 0.34
5 0.36
6 0.39
7 0.42
8 0.46
9 0.52
10 0.5
11 0.48
12 0.47
13 0.48
14 0.46
15 0.5
16 0.49
17 0.45
18 0.48
19 0.54
20 0.6
21 0.65
22 0.71
23 0.7
24 0.76
25 0.82
26 0.85
27 0.86
28 0.84
29 0.82
30 0.79
31 0.79
32 0.71
33 0.68
34 0.6
35 0.54
36 0.49
37 0.42
38 0.39
39 0.34
40 0.36
41 0.3
42 0.34
43 0.33
44 0.31
45 0.34
46 0.31
47 0.3
48 0.3
49 0.3
50 0.25
51 0.24
52 0.23
53 0.25
54 0.26
55 0.27