Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LWW3

Protein Details
Accession E2LWW3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-82GKSRGSTRGKPQRKSKKNPGEKWEVDBasic
NLS Segment(s)
PositionSequence
52-76GSKSSGKSRGSTRGKPQRKSKKNPG
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025313  DUF4217  
KEGG mpr:MPER_11754  -  
Pfam View protein in Pfam  
PF13959  DUF4217  
Amino Acid Sequences NAGLARRAFLSHMRAYATHPSDEKHMFHIRHLHIGHLAKSFALREAPKAITGSKSSGKSRGSTRGKPQRKSKKNPGEKWEVDHSGDAEKRMQDAVRSQGRQTKKSGVMVSSGTSEFQIAGGYDLEKLFGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.37
4 0.35
5 0.32
6 0.3
7 0.29
8 0.33
9 0.36
10 0.33
11 0.3
12 0.35
13 0.32
14 0.35
15 0.43
16 0.39
17 0.43
18 0.42
19 0.37
20 0.35
21 0.37
22 0.35
23 0.28
24 0.26
25 0.18
26 0.19
27 0.18
28 0.13
29 0.15
30 0.13
31 0.13
32 0.17
33 0.18
34 0.18
35 0.19
36 0.18
37 0.16
38 0.17
39 0.19
40 0.2
41 0.23
42 0.23
43 0.27
44 0.27
45 0.28
46 0.3
47 0.37
48 0.39
49 0.4
50 0.49
51 0.55
52 0.61
53 0.66
54 0.73
55 0.74
56 0.77
57 0.82
58 0.83
59 0.83
60 0.86
61 0.86
62 0.82
63 0.81
64 0.72
65 0.67
66 0.62
67 0.53
68 0.44
69 0.36
70 0.31
71 0.25
72 0.25
73 0.21
74 0.18
75 0.16
76 0.15
77 0.16
78 0.16
79 0.13
80 0.16
81 0.23
82 0.28
83 0.3
84 0.31
85 0.37
86 0.42
87 0.43
88 0.44
89 0.45
90 0.41
91 0.46
92 0.47
93 0.41
94 0.38
95 0.36
96 0.33
97 0.27
98 0.23
99 0.17
100 0.15
101 0.14
102 0.11
103 0.1
104 0.09
105 0.07
106 0.08
107 0.08
108 0.08
109 0.09
110 0.09
111 0.1