Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P9Q0

Protein Details
Accession A0A5C3P9Q0    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-49NAEPRRSSRIKEQPKPEPAPKKAPAKPRTKKVKEPAAEHydrophilic
NLS Segment(s)
PositionSequence
15-62PRRSSRIKEQPKPEPAPKKAPAKPRTKKVKEPAAEGEEKPKSTKGRKR
81-155PAKKAKPSSKAAGKPASKAAAAKPASKASRAGSAKPASRAASAKPASRASAKPASTAKKPASRAGSKKPASKAGA
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPRKAAATAETNAEPRRSSRIKEQPKPEPAPKKAPAKPRTKKVKEPAAEGEEKPKSTKGRKRTAADVEAEDGAAVNGEEPPAKKAKPSSKAAGKPASKAAAAKPASKASRAGSAKPASRAASAKPASRASAKPASTAKKPASRAGSKKPASKAGAAEKENGAAAAPETIAEEPEAEAAAEANGEQPPAEETTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.33
4 0.32
5 0.35
6 0.41
7 0.5
8 0.59
9 0.67
10 0.74
11 0.75
12 0.8
13 0.84
14 0.83
15 0.82
16 0.77
17 0.78
18 0.76
19 0.76
20 0.73
21 0.75
22 0.75
23 0.76
24 0.79
25 0.8
26 0.84
27 0.81
28 0.85
29 0.84
30 0.85
31 0.77
32 0.74
33 0.71
34 0.66
35 0.62
36 0.53
37 0.51
38 0.44
39 0.41
40 0.37
41 0.34
42 0.34
43 0.4
44 0.48
45 0.49
46 0.56
47 0.64
48 0.67
49 0.7
50 0.7
51 0.64
52 0.59
53 0.51
54 0.42
55 0.33
56 0.29
57 0.21
58 0.13
59 0.09
60 0.06
61 0.04
62 0.03
63 0.03
64 0.03
65 0.04
66 0.05
67 0.07
68 0.1
69 0.1
70 0.12
71 0.19
72 0.27
73 0.33
74 0.37
75 0.43
76 0.48
77 0.53
78 0.56
79 0.58
80 0.5
81 0.45
82 0.42
83 0.37
84 0.29
85 0.25
86 0.21
87 0.21
88 0.22
89 0.22
90 0.21
91 0.25
92 0.26
93 0.26
94 0.26
95 0.19
96 0.27
97 0.26
98 0.26
99 0.27
100 0.3
101 0.32
102 0.32
103 0.34
104 0.26
105 0.27
106 0.27
107 0.22
108 0.27
109 0.27
110 0.27
111 0.28
112 0.28
113 0.28
114 0.31
115 0.3
116 0.27
117 0.33
118 0.31
119 0.31
120 0.36
121 0.38
122 0.38
123 0.44
124 0.43
125 0.42
126 0.45
127 0.47
128 0.49
129 0.53
130 0.56
131 0.59
132 0.64
133 0.62
134 0.66
135 0.63
136 0.63
137 0.57
138 0.54
139 0.5
140 0.49
141 0.52
142 0.47
143 0.46
144 0.38
145 0.36
146 0.33
147 0.27
148 0.18
149 0.1
150 0.09
151 0.07
152 0.06
153 0.05
154 0.07
155 0.07
156 0.08
157 0.07
158 0.08
159 0.07
160 0.08
161 0.08
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.05
168 0.06
169 0.06
170 0.07
171 0.06
172 0.07
173 0.09
174 0.11