Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P7U9

Protein Details
Accession A0A5C3P7U9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-66EAIRQEKQQRKKQKIVRLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MPASREPPDRDPLAAALRPPIDETEEEKASRLADEEAAKRVSHAIDEAIRQEKQQRKKQKIVRLLLLGQSESGKSTTLRRGLFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.24
4 0.23
5 0.22
6 0.21
7 0.19
8 0.16
9 0.16
10 0.19
11 0.21
12 0.22
13 0.22
14 0.21
15 0.21
16 0.19
17 0.17
18 0.14
19 0.09
20 0.1
21 0.13
22 0.14
23 0.16
24 0.17
25 0.16
26 0.15
27 0.15
28 0.13
29 0.1
30 0.09
31 0.08
32 0.08
33 0.09
34 0.11
35 0.13
36 0.14
37 0.14
38 0.22
39 0.28
40 0.36
41 0.45
42 0.53
43 0.59
44 0.68
45 0.76
46 0.78
47 0.8
48 0.77
49 0.74
50 0.68
51 0.62
52 0.57
53 0.5
54 0.4
55 0.31
56 0.26
57 0.19
58 0.16
59 0.14
60 0.11
61 0.11
62 0.16
63 0.23
64 0.29