Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NRW4

Protein Details
Accession A0A5C3NRW4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-51GVKRTLYPWTTRRRRQHQKLSKQERKDLQAHydrophilic
NLS Segment(s)
PositionSequence
12-53KKIAKPSRKVGVKRTLYPWTTRRRRQHQKLSKQERKDLQARR
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPSSSNIEKLLKKIAKPSRKVGVKRTLYPWTTRRRRQHQKLSKQERKDLQARRDGNRAALKAALHAARSEIYERATEMAAQFGHKHTPGYYYRLIMQQSKLKEEPRKISLWNAFVSKEVERHNAEVASGDRDNVSKGVIKEIARKWKSLSPEEREAEVGDRLEELQGRQSERKLVVHNEALAAFNDTRATLALIQRELEYLKGRTDTVMSSELA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.62
4 0.66
5 0.66
6 0.71
7 0.74
8 0.74
9 0.74
10 0.71
11 0.71
12 0.7
13 0.68
14 0.62
15 0.63
16 0.62
17 0.62
18 0.66
19 0.69
20 0.74
21 0.76
22 0.85
23 0.88
24 0.92
25 0.91
26 0.92
27 0.94
28 0.95
29 0.93
30 0.88
31 0.86
32 0.82
33 0.78
34 0.76
35 0.74
36 0.7
37 0.7
38 0.68
39 0.64
40 0.64
41 0.57
42 0.55
43 0.52
44 0.45
45 0.37
46 0.33
47 0.29
48 0.23
49 0.26
50 0.2
51 0.14
52 0.14
53 0.13
54 0.12
55 0.13
56 0.13
57 0.11
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.09
65 0.1
66 0.09
67 0.09
68 0.1
69 0.09
70 0.11
71 0.11
72 0.12
73 0.1
74 0.15
75 0.17
76 0.21
77 0.21
78 0.2
79 0.22
80 0.24
81 0.26
82 0.23
83 0.24
84 0.23
85 0.23
86 0.26
87 0.27
88 0.29
89 0.33
90 0.36
91 0.37
92 0.36
93 0.37
94 0.33
95 0.37
96 0.35
97 0.32
98 0.29
99 0.25
100 0.22
101 0.21
102 0.22
103 0.17
104 0.16
105 0.16
106 0.19
107 0.19
108 0.2
109 0.2
110 0.18
111 0.17
112 0.15
113 0.14
114 0.14
115 0.12
116 0.12
117 0.11
118 0.11
119 0.12
120 0.1
121 0.1
122 0.1
123 0.1
124 0.13
125 0.17
126 0.18
127 0.25
128 0.3
129 0.4
130 0.38
131 0.38
132 0.39
133 0.39
134 0.43
135 0.44
136 0.47
137 0.43
138 0.5
139 0.51
140 0.49
141 0.46
142 0.41
143 0.34
144 0.28
145 0.21
146 0.13
147 0.11
148 0.11
149 0.11
150 0.11
151 0.09
152 0.14
153 0.17
154 0.2
155 0.23
156 0.24
157 0.28
158 0.3
159 0.34
160 0.33
161 0.34
162 0.36
163 0.37
164 0.36
165 0.32
166 0.29
167 0.26
168 0.22
169 0.21
170 0.15
171 0.13
172 0.13
173 0.11
174 0.11
175 0.11
176 0.12
177 0.12
178 0.15
179 0.18
180 0.19
181 0.2
182 0.2
183 0.21
184 0.19
185 0.19
186 0.21
187 0.18
188 0.2
189 0.21
190 0.21
191 0.21
192 0.22
193 0.21
194 0.2