Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PHS6

Protein Details
Accession A0A5C3PHS6    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-48VAIGYRMRINRERRKRRKRREEDGRDGIGRBasic
NLS Segment(s)
PositionSequence
26-39RINRERRKRRKRRE
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
Amino Acid Sequences MHGDRWDPGILQPADGREVAIGYRMRINRERRKRRKRREEDGRDGIGRSLSVSCMAETACGRRSLQLVQAGLESTPGPGWDSRLDSKTCMPFAVCCLPLPHAHRQTLDSGPGSAPGPNAGRRTQSGTCCESRGYVDRGPPRIGKASLSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.12
5 0.13
6 0.11
7 0.14
8 0.14
9 0.13
10 0.19
11 0.21
12 0.27
13 0.34
14 0.44
15 0.5
16 0.6
17 0.71
18 0.75
19 0.85
20 0.91
21 0.95
22 0.96
23 0.95
24 0.95
25 0.95
26 0.94
27 0.93
28 0.89
29 0.82
30 0.72
31 0.62
32 0.51
33 0.4
34 0.29
35 0.2
36 0.13
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.11
46 0.11
47 0.12
48 0.12
49 0.13
50 0.15
51 0.14
52 0.18
53 0.19
54 0.17
55 0.16
56 0.16
57 0.15
58 0.13
59 0.13
60 0.09
61 0.05
62 0.05
63 0.04
64 0.05
65 0.05
66 0.07
67 0.08
68 0.11
69 0.13
70 0.17
71 0.17
72 0.18
73 0.22
74 0.23
75 0.22
76 0.19
77 0.17
78 0.15
79 0.18
80 0.21
81 0.18
82 0.15
83 0.16
84 0.17
85 0.22
86 0.26
87 0.31
88 0.31
89 0.33
90 0.33
91 0.34
92 0.36
93 0.34
94 0.32
95 0.24
96 0.2
97 0.18
98 0.19
99 0.17
100 0.14
101 0.12
102 0.12
103 0.14
104 0.17
105 0.21
106 0.21
107 0.24
108 0.25
109 0.32
110 0.34
111 0.36
112 0.38
113 0.4
114 0.41
115 0.39
116 0.38
117 0.32
118 0.32
119 0.32
120 0.32
121 0.3
122 0.36
123 0.41
124 0.45
125 0.48
126 0.46
127 0.46
128 0.47
129 0.44