Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PAW4

Protein Details
Accession A0A5C3PAW4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
160-181RDKWGERKKLQADIRRKRKEFWBasic
NLS Segment(s)
PositionSequence
142-179RADRKKVVAKVEEAHAANRDKWGERKKLQADIRRKRKE
Subcellular Location(s) mito 14, cyto_mito 10, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MKPRLSLFPSPLRFTRSYATRLPERPPARAPDPLRNNPHAVYKELPENVTFIHRPPPTAPSPLSYTTSPASPLLQPSATPVDGPLPPTLRKDKGEKPPVSEEDIARIRQLRREDPETWTRGRLAAEFNCTQWFVGKITSLKRADRKKVVAKVEEAHAANRDKWGERKKLQADIRRKRKEFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.43
4 0.42
5 0.43
6 0.46
7 0.48
8 0.5
9 0.51
10 0.54
11 0.52
12 0.52
13 0.51
14 0.52
15 0.48
16 0.53
17 0.54
18 0.54
19 0.6
20 0.64
21 0.66
22 0.62
23 0.61
24 0.54
25 0.57
26 0.48
27 0.42
28 0.36
29 0.32
30 0.34
31 0.32
32 0.31
33 0.24
34 0.22
35 0.19
36 0.22
37 0.2
38 0.15
39 0.22
40 0.21
41 0.23
42 0.24
43 0.28
44 0.27
45 0.3
46 0.3
47 0.24
48 0.28
49 0.29
50 0.3
51 0.25
52 0.25
53 0.21
54 0.21
55 0.19
56 0.15
57 0.15
58 0.12
59 0.13
60 0.12
61 0.12
62 0.11
63 0.12
64 0.14
65 0.13
66 0.12
67 0.11
68 0.12
69 0.12
70 0.14
71 0.13
72 0.12
73 0.13
74 0.17
75 0.21
76 0.21
77 0.23
78 0.28
79 0.34
80 0.42
81 0.5
82 0.49
83 0.49
84 0.52
85 0.52
86 0.5
87 0.44
88 0.34
89 0.3
90 0.32
91 0.27
92 0.22
93 0.24
94 0.2
95 0.23
96 0.27
97 0.26
98 0.3
99 0.35
100 0.36
101 0.38
102 0.44
103 0.43
104 0.41
105 0.37
106 0.32
107 0.28
108 0.27
109 0.23
110 0.21
111 0.2
112 0.23
113 0.23
114 0.23
115 0.23
116 0.22
117 0.21
118 0.17
119 0.16
120 0.12
121 0.12
122 0.14
123 0.16
124 0.19
125 0.28
126 0.3
127 0.34
128 0.42
129 0.5
130 0.55
131 0.6
132 0.65
133 0.66
134 0.71
135 0.72
136 0.68
137 0.63
138 0.58
139 0.53
140 0.51
141 0.42
142 0.36
143 0.34
144 0.33
145 0.29
146 0.3
147 0.3
148 0.28
149 0.36
150 0.43
151 0.48
152 0.49
153 0.59
154 0.6
155 0.66
156 0.72
157 0.72
158 0.75
159 0.76
160 0.83
161 0.83