Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PY41

Protein Details
Accession A0A5C3PY41    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
158-177GTGGRRRLHRIRRAEQQQASHydrophilic
NLS Segment(s)
PositionSequence
162-165RRRL
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MNTTPKEPNASQRTSVQLGRELLTPAQKRTLFQASHHHLQDQCLDEDAALSRASDAAATPSHQRWTRRIITSNRDATAATVTHLYLQAPPPGELGCTDIACTLPLFFRADDSLLRHPRTEDVHSPCITGALPLGGESGAAASQRCPLQKPAEHGRVGGTGGRRRLHRIRRAEQQQASELTWAEVVTGKKVGCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.4
4 0.38
5 0.35
6 0.34
7 0.32
8 0.28
9 0.26
10 0.32
11 0.32
12 0.28
13 0.34
14 0.34
15 0.33
16 0.37
17 0.43
18 0.36
19 0.36
20 0.44
21 0.44
22 0.5
23 0.5
24 0.48
25 0.4
26 0.41
27 0.43
28 0.35
29 0.29
30 0.23
31 0.22
32 0.18
33 0.18
34 0.17
35 0.12
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.06
44 0.07
45 0.08
46 0.12
47 0.13
48 0.19
49 0.23
50 0.26
51 0.27
52 0.34
53 0.4
54 0.42
55 0.48
56 0.49
57 0.52
58 0.58
59 0.58
60 0.51
61 0.44
62 0.39
63 0.32
64 0.28
65 0.2
66 0.13
67 0.09
68 0.08
69 0.09
70 0.09
71 0.08
72 0.08
73 0.09
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.11
80 0.09
81 0.1
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.05
90 0.04
91 0.06
92 0.07
93 0.07
94 0.07
95 0.08
96 0.09
97 0.1
98 0.13
99 0.2
100 0.24
101 0.25
102 0.25
103 0.25
104 0.27
105 0.29
106 0.31
107 0.3
108 0.32
109 0.36
110 0.36
111 0.36
112 0.32
113 0.3
114 0.25
115 0.17
116 0.11
117 0.06
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.09
130 0.11
131 0.13
132 0.15
133 0.19
134 0.27
135 0.31
136 0.37
137 0.44
138 0.48
139 0.48
140 0.46
141 0.43
142 0.37
143 0.34
144 0.3
145 0.27
146 0.25
147 0.3
148 0.33
149 0.33
150 0.4
151 0.49
152 0.56
153 0.59
154 0.64
155 0.66
156 0.73
157 0.79
158 0.81
159 0.77
160 0.71
161 0.67
162 0.6
163 0.53
164 0.44
165 0.36
166 0.27
167 0.22
168 0.17
169 0.13
170 0.14
171 0.14
172 0.15
173 0.18