Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P014

Protein Details
Accession A0A5C3P014    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23RSAVRKRDKHCKVTKQGPAERARBasic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 5, pero 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
Pfam View protein in Pfam  
PF13391  HNH_2  
Amino Acid Sequences RSAVRKRDKHCKVTKQGPAERARGTDYTTLEVAHIFPLGYAGHPQVIEWLTQDPEAQDVVPLVEDRKEADKPWNAILLRCDIHRFFDTFQWGVWKVRLMTSSSAFGGTAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.83
4 0.81
5 0.76
6 0.7
7 0.62
8 0.54
9 0.49
10 0.4
11 0.36
12 0.32
13 0.27
14 0.25
15 0.23
16 0.21
17 0.17
18 0.17
19 0.14
20 0.1
21 0.09
22 0.06
23 0.05
24 0.06
25 0.06
26 0.06
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.09
40 0.07
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.07
53 0.1
54 0.11
55 0.12
56 0.19
57 0.23
58 0.25
59 0.26
60 0.31
61 0.28
62 0.29
63 0.29
64 0.27
65 0.23
66 0.22
67 0.24
68 0.18
69 0.22
70 0.23
71 0.23
72 0.21
73 0.24
74 0.28
75 0.25
76 0.25
77 0.26
78 0.26
79 0.26
80 0.26
81 0.25
82 0.21
83 0.24
84 0.26
85 0.24
86 0.26
87 0.27
88 0.28
89 0.25
90 0.24
91 0.21