Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PHM9

Protein Details
Accession A0A5C3PHM9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-31PGCWRDCRCTRNPQRCGRCRWCSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 7, plas 6, cyto 2, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MWRVLVLPGCWRDCRCTRNPQRCGRCRWCSARREANDNVVRVSAGRRRRSVGCLLRFICIVAHFTICSQVYVAWACRSEVAVRLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.53
4 0.61
5 0.67
6 0.75
7 0.78
8 0.83
9 0.83
10 0.87
11 0.85
12 0.81
13 0.78
14 0.79
15 0.77
16 0.73
17 0.74
18 0.73
19 0.67
20 0.66
21 0.59
22 0.59
23 0.55
24 0.48
25 0.4
26 0.3
27 0.27
28 0.21
29 0.22
30 0.18
31 0.22
32 0.25
33 0.26
34 0.3
35 0.32
36 0.36
37 0.42
38 0.45
39 0.42
40 0.45
41 0.44
42 0.41
43 0.39
44 0.36
45 0.27
46 0.19
47 0.17
48 0.11
49 0.11
50 0.1
51 0.1
52 0.14
53 0.14
54 0.13
55 0.12
56 0.11
57 0.12
58 0.15
59 0.17
60 0.15
61 0.16
62 0.16
63 0.16
64 0.18
65 0.17
66 0.22