Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P6N7

Protein Details
Accession A0A5C3P6N7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLSRRRLFKQCRHAYREPVRVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 3
Family & Domain DBs
Amino Acid Sequences MLSRRRLFKQCRHAYREPVRVPSPRRSIRRSSLPRSSLISRAIEAVGLGADLTTCISSDYSIWTLVADATVNEVASQLIIPTACSPAVQWGVSGLGGSAPSLDGEPSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.83
4 0.76
5 0.72
6 0.68
7 0.67
8 0.65
9 0.64
10 0.65
11 0.63
12 0.66
13 0.65
14 0.67
15 0.67
16 0.73
17 0.73
18 0.7
19 0.7
20 0.66
21 0.62
22 0.59
23 0.54
24 0.46
25 0.4
26 0.34
27 0.25
28 0.23
29 0.21
30 0.16
31 0.13
32 0.09
33 0.06
34 0.04
35 0.04
36 0.02
37 0.02
38 0.02
39 0.03
40 0.02
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.05
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.03
65 0.04
66 0.04
67 0.05
68 0.06
69 0.07
70 0.07
71 0.07
72 0.08
73 0.12
74 0.14
75 0.14
76 0.13
77 0.12
78 0.13
79 0.13
80 0.13
81 0.08
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06