Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PEZ0

Protein Details
Accession A0A5C3PEZ0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-125NTKGQEYQPSQRKRKRKHGFLTRKRSVNGRKMLARRRAKGRLFHydrophilic
NLS Segment(s)
PositionSequence
94-123RKRKRKHGFLTRKRSVNGRKMLARRRAKGR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSLARLLSRPPVLPAAVVPRATSSSSFASSLVPLRPILPSTLPTSSLLRALPSLLSRFNPAPSIASSVFSPLLQVRHNTKGQEYQPSQRKRKRKHGFLTRKRSVNGRKMLARRRAKGRLFVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.31
4 0.28
5 0.26
6 0.22
7 0.23
8 0.24
9 0.23
10 0.21
11 0.2
12 0.21
13 0.22
14 0.21
15 0.17
16 0.16
17 0.18
18 0.18
19 0.17
20 0.15
21 0.16
22 0.17
23 0.15
24 0.14
25 0.12
26 0.12
27 0.13
28 0.13
29 0.13
30 0.12
31 0.13
32 0.15
33 0.16
34 0.16
35 0.17
36 0.18
37 0.17
38 0.17
39 0.15
40 0.12
41 0.12
42 0.1
43 0.1
44 0.09
45 0.1
46 0.09
47 0.1
48 0.12
49 0.12
50 0.13
51 0.13
52 0.12
53 0.12
54 0.11
55 0.15
56 0.13
57 0.13
58 0.13
59 0.13
60 0.13
61 0.11
62 0.12
63 0.09
64 0.1
65 0.11
66 0.14
67 0.17
68 0.22
69 0.25
70 0.25
71 0.26
72 0.31
73 0.32
74 0.39
75 0.38
76 0.42
77 0.49
78 0.58
79 0.66
80 0.67
81 0.75
82 0.75
83 0.83
84 0.84
85 0.86
86 0.87
87 0.88
88 0.91
89 0.92
90 0.93
91 0.9
92 0.86
93 0.77
94 0.76
95 0.74
96 0.72
97 0.7
98 0.67
99 0.67
100 0.7
101 0.78
102 0.78
103 0.78
104 0.77
105 0.78
106 0.8
107 0.77
108 0.77