Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PCA4

Protein Details
Accession A0A5C3PCA4    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-119VVSRLPWKARLQRRPSSRRLCDLKKQWSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 14.333, cyto 9, cyto_pero 5.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
Amino Acid Sequences YIHSRGIVHCDIKPGNLMLGSDASEPSRVRFIDFALCRPYKNLDTAEHLPDKGTSHFLGSRLFISLNGHLHHSSSRRDDIEAMSYTLLALVVSRLPWKARLQRRPSSRRLCDLKKQWSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.2
4 0.18
5 0.13
6 0.13
7 0.13
8 0.12
9 0.12
10 0.11
11 0.13
12 0.13
13 0.13
14 0.17
15 0.15
16 0.16
17 0.16
18 0.17
19 0.23
20 0.24
21 0.26
22 0.29
23 0.29
24 0.28
25 0.29
26 0.32
27 0.24
28 0.27
29 0.26
30 0.21
31 0.27
32 0.3
33 0.33
34 0.3
35 0.28
36 0.25
37 0.23
38 0.22
39 0.16
40 0.16
41 0.11
42 0.12
43 0.13
44 0.14
45 0.14
46 0.13
47 0.12
48 0.11
49 0.1
50 0.09
51 0.1
52 0.11
53 0.12
54 0.12
55 0.14
56 0.13
57 0.13
58 0.16
59 0.17
60 0.18
61 0.2
62 0.24
63 0.22
64 0.23
65 0.24
66 0.23
67 0.25
68 0.22
69 0.19
70 0.15
71 0.14
72 0.13
73 0.12
74 0.1
75 0.05
76 0.04
77 0.04
78 0.04
79 0.05
80 0.07
81 0.08
82 0.1
83 0.14
84 0.22
85 0.31
86 0.41
87 0.51
88 0.58
89 0.66
90 0.76
91 0.81
92 0.84
93 0.85
94 0.81
95 0.81
96 0.82
97 0.81
98 0.81
99 0.82