Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PYH1

Protein Details
Accession A0A5C3PYH1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
292-314AEEEGGPKKKKKKEGPGVTARNMBasic
NLS Segment(s)
PositionSequence
297-307GPKKKKKKEGP
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045144  TAF4  
IPR007900  TAF4_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF05236  TAF4  
CDD cd08045  TAF4  
Amino Acid Sequences MKAEDSQPPPATTTFSAAQWPQTSQIPIDPALQQQSQVPQHSTTTPYSHYQYGHYAQTSYSHYPQYAQQTHQPAAQASTSQTQTPTPAAQPVIAASTVIRPATQPAQQSQQSGVDTTDVATLNDALGSAGVDLRAEEESLQRTNDQYYSYRPYEDRSRKQPDKPQFDTVHLGNTMRTISARYKVPTVPKESMDYVALALRFRLQSLLTSMIAAAKHRTDTQFDRPASTYEDGTPMWSIKVRSDVGKQLEALQKAYREEDIKERRERKERQDAQAAQAAALTATANGAEGPGAEEEGGPKKKKKKEGPGVTARNMSEDVRKKMSNAVASQAAGLGTGKYAWMSAANAGAAAAKPKPAARASTPATTTAPAASSNSSASRWARPYQGSKTTSQQQQKDADGRLAITLADAVFVVNNEKGHGGGRGAARGWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.28
4 0.27
5 0.31
6 0.29
7 0.29
8 0.27
9 0.29
10 0.3
11 0.26
12 0.29
13 0.26
14 0.25
15 0.27
16 0.26
17 0.25
18 0.29
19 0.28
20 0.25
21 0.24
22 0.31
23 0.34
24 0.36
25 0.35
26 0.32
27 0.34
28 0.36
29 0.37
30 0.33
31 0.31
32 0.3
33 0.32
34 0.34
35 0.35
36 0.34
37 0.32
38 0.35
39 0.35
40 0.36
41 0.33
42 0.3
43 0.26
44 0.29
45 0.32
46 0.31
47 0.31
48 0.28
49 0.28
50 0.29
51 0.34
52 0.39
53 0.39
54 0.37
55 0.4
56 0.44
57 0.45
58 0.45
59 0.42
60 0.32
61 0.3
62 0.28
63 0.22
64 0.18
65 0.22
66 0.21
67 0.2
68 0.2
69 0.19
70 0.2
71 0.22
72 0.21
73 0.18
74 0.2
75 0.2
76 0.19
77 0.18
78 0.16
79 0.15
80 0.13
81 0.11
82 0.08
83 0.1
84 0.11
85 0.11
86 0.1
87 0.09
88 0.13
89 0.17
90 0.2
91 0.2
92 0.22
93 0.29
94 0.31
95 0.32
96 0.31
97 0.31
98 0.28
99 0.26
100 0.23
101 0.16
102 0.14
103 0.14
104 0.14
105 0.11
106 0.1
107 0.1
108 0.09
109 0.09
110 0.08
111 0.08
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.05
123 0.06
124 0.08
125 0.11
126 0.12
127 0.13
128 0.12
129 0.13
130 0.15
131 0.15
132 0.16
133 0.15
134 0.19
135 0.25
136 0.25
137 0.27
138 0.25
139 0.29
140 0.37
141 0.45
142 0.48
143 0.51
144 0.6
145 0.64
146 0.71
147 0.76
148 0.75
149 0.75
150 0.72
151 0.71
152 0.63
153 0.59
154 0.56
155 0.47
156 0.4
157 0.31
158 0.26
159 0.18
160 0.17
161 0.14
162 0.1
163 0.1
164 0.09
165 0.11
166 0.15
167 0.18
168 0.18
169 0.21
170 0.24
171 0.31
172 0.33
173 0.37
174 0.35
175 0.34
176 0.35
177 0.33
178 0.31
179 0.25
180 0.2
181 0.14
182 0.13
183 0.12
184 0.09
185 0.08
186 0.09
187 0.08
188 0.08
189 0.09
190 0.07
191 0.07
192 0.1
193 0.12
194 0.1
195 0.1
196 0.1
197 0.11
198 0.11
199 0.1
200 0.09
201 0.08
202 0.08
203 0.1
204 0.11
205 0.13
206 0.18
207 0.25
208 0.32
209 0.32
210 0.34
211 0.33
212 0.33
213 0.33
214 0.29
215 0.23
216 0.15
217 0.17
218 0.14
219 0.14
220 0.13
221 0.1
222 0.09
223 0.1
224 0.1
225 0.09
226 0.14
227 0.14
228 0.16
229 0.18
230 0.24
231 0.24
232 0.25
233 0.24
234 0.26
235 0.29
236 0.28
237 0.26
238 0.22
239 0.21
240 0.21
241 0.22
242 0.18
243 0.15
244 0.16
245 0.24
246 0.31
247 0.36
248 0.44
249 0.49
250 0.54
251 0.62
252 0.68
253 0.67
254 0.7
255 0.71
256 0.69
257 0.72
258 0.67
259 0.61
260 0.58
261 0.49
262 0.37
263 0.3
264 0.24
265 0.13
266 0.12
267 0.08
268 0.04
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.03
276 0.04
277 0.04
278 0.04
279 0.05
280 0.05
281 0.07
282 0.14
283 0.19
284 0.21
285 0.28
286 0.37
287 0.44
288 0.54
289 0.62
290 0.67
291 0.73
292 0.8
293 0.84
294 0.86
295 0.85
296 0.79
297 0.73
298 0.62
299 0.53
300 0.44
301 0.35
302 0.33
303 0.33
304 0.34
305 0.35
306 0.35
307 0.34
308 0.39
309 0.42
310 0.39
311 0.34
312 0.32
313 0.29
314 0.29
315 0.28
316 0.22
317 0.17
318 0.12
319 0.11
320 0.07
321 0.05
322 0.05
323 0.05
324 0.05
325 0.05
326 0.05
327 0.06
328 0.07
329 0.07
330 0.08
331 0.08
332 0.08
333 0.08
334 0.09
335 0.08
336 0.09
337 0.09
338 0.09
339 0.11
340 0.12
341 0.17
342 0.19
343 0.24
344 0.26
345 0.33
346 0.36
347 0.41
348 0.41
349 0.39
350 0.38
351 0.34
352 0.3
353 0.23
354 0.2
355 0.15
356 0.15
357 0.14
358 0.14
359 0.15
360 0.16
361 0.16
362 0.2
363 0.22
364 0.27
365 0.3
366 0.32
367 0.37
368 0.42
369 0.48
370 0.52
371 0.58
372 0.55
373 0.54
374 0.58
375 0.61
376 0.63
377 0.65
378 0.62
379 0.6
380 0.61
381 0.65
382 0.64
383 0.57
384 0.52
385 0.44
386 0.39
387 0.33
388 0.28
389 0.2
390 0.14
391 0.13
392 0.09
393 0.08
394 0.07
395 0.06
396 0.06
397 0.07
398 0.1
399 0.1
400 0.11
401 0.12
402 0.12
403 0.13
404 0.14
405 0.15
406 0.14
407 0.17
408 0.19
409 0.21