Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PY64

Protein Details
Accession A0A5C3PY64    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
64-89VTRGAGFRKEKNKKKRGSYRGGEITMHydrophilic
NLS Segment(s)
PositionSequence
13-19EGKKPKK
69-80GFRKEKNKKKRG
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences TPQPNARGKNNGEGKKPKKVNAPFQRVKAEEVTYIDPRLKDNRFESRGASASDYGARASRDLIVTRGAGFRKEKNKKKRGSYRGGEITMESHSIKFTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.72
4 0.67
5 0.68
6 0.7
7 0.72
8 0.72
9 0.77
10 0.73
11 0.73
12 0.74
13 0.65
14 0.6
15 0.52
16 0.42
17 0.33
18 0.3
19 0.29
20 0.23
21 0.23
22 0.22
23 0.19
24 0.2
25 0.25
26 0.23
27 0.24
28 0.27
29 0.35
30 0.36
31 0.37
32 0.36
33 0.32
34 0.33
35 0.29
36 0.25
37 0.17
38 0.14
39 0.14
40 0.13
41 0.1
42 0.1
43 0.09
44 0.08
45 0.09
46 0.1
47 0.1
48 0.11
49 0.11
50 0.11
51 0.11
52 0.12
53 0.15
54 0.14
55 0.17
56 0.19
57 0.25
58 0.35
59 0.45
60 0.54
61 0.62
62 0.71
63 0.76
64 0.84
65 0.88
66 0.87
67 0.87
68 0.84
69 0.83
70 0.81
71 0.74
72 0.64
73 0.54
74 0.45
75 0.37
76 0.32
77 0.23
78 0.15