Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PL60

Protein Details
Accession A0A5C3PL60    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-47RTECRATPSHPRLRRRARRRVHRFRRVLSPSBasic
NLS Segment(s)
PositionSequence
27-42PRLRRRARRRVHRFRR
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MGQTIRPIRHGNSATTRTECRATPSHPRLRRRARRRVHRFRRVLSPSLRVVPHSRTAHIELGILVTAYFFSPTALGLRALLAVAVSSPNLIVTKTNSIHIRIYIILPPILVTTRQYKRATQDSRQLSGSILQNVEGSLRRSRSWLPLPRSLYPFPIPPIVCFRAVLSPCCCST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.49
4 0.43
5 0.43
6 0.37
7 0.34
8 0.35
9 0.36
10 0.42
11 0.49
12 0.57
13 0.62
14 0.69
15 0.74
16 0.8
17 0.86
18 0.85
19 0.86
20 0.86
21 0.89
22 0.93
23 0.94
24 0.93
25 0.93
26 0.91
27 0.85
28 0.85
29 0.79
30 0.75
31 0.68
32 0.62
33 0.55
34 0.51
35 0.47
36 0.39
37 0.36
38 0.33
39 0.37
40 0.33
41 0.32
42 0.3
43 0.34
44 0.33
45 0.3
46 0.26
47 0.17
48 0.16
49 0.14
50 0.11
51 0.07
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.02
74 0.02
75 0.03
76 0.03
77 0.04
78 0.04
79 0.06
80 0.11
81 0.12
82 0.15
83 0.16
84 0.18
85 0.19
86 0.18
87 0.18
88 0.14
89 0.15
90 0.13
91 0.13
92 0.11
93 0.1
94 0.1
95 0.09
96 0.09
97 0.08
98 0.08
99 0.16
100 0.19
101 0.27
102 0.29
103 0.31
104 0.36
105 0.46
106 0.5
107 0.47
108 0.53
109 0.51
110 0.52
111 0.51
112 0.45
113 0.36
114 0.34
115 0.32
116 0.26
117 0.2
118 0.18
119 0.17
120 0.16
121 0.18
122 0.15
123 0.15
124 0.17
125 0.19
126 0.19
127 0.23
128 0.25
129 0.32
130 0.39
131 0.46
132 0.47
133 0.53
134 0.58
135 0.61
136 0.64
137 0.57
138 0.53
139 0.47
140 0.44
141 0.39
142 0.41
143 0.36
144 0.33
145 0.39
146 0.37
147 0.35
148 0.32
149 0.31
150 0.32
151 0.34
152 0.36
153 0.31