Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PMZ2

Protein Details
Accession A0A5C3PMZ2    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
73-102RSLVHRRSCPRSPSRPQCTRPWPRITDNRSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, cyto 5.5, cyto_nucl 4.5, plas 4, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MTFPFAPLLLFSSCLHLKLFSAYIPVCFFWQDISSSHNVSRLAPRIGAHAPPWNLLSTSNDIIESLVSRLAPRSLVHRRSCPRSPSRPQCTRPWPRITDNRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.16
5 0.17
6 0.17
7 0.12
8 0.15
9 0.14
10 0.15
11 0.16
12 0.16
13 0.14
14 0.14
15 0.14
16 0.11
17 0.12
18 0.11
19 0.1
20 0.13
21 0.15
22 0.16
23 0.16
24 0.18
25 0.17
26 0.17
27 0.21
28 0.22
29 0.21
30 0.2
31 0.2
32 0.2
33 0.21
34 0.2
35 0.17
36 0.18
37 0.18
38 0.17
39 0.18
40 0.15
41 0.14
42 0.13
43 0.14
44 0.13
45 0.14
46 0.13
47 0.12
48 0.12
49 0.12
50 0.11
51 0.09
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.09
59 0.08
60 0.16
61 0.25
62 0.33
63 0.38
64 0.47
65 0.53
66 0.6
67 0.66
68 0.67
69 0.67
70 0.69
71 0.76
72 0.77
73 0.81
74 0.83
75 0.81
76 0.82
77 0.84
78 0.84
79 0.82
80 0.8
81 0.76
82 0.76
83 0.81