Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PMX2

Protein Details
Accession A0A5C3PMX2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-42TWAARGRIECRRRRHRPCPTSKCALLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8extr 8, plas 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MMMLLWLLQIFSCVCVTWAARGRIECRRRRHRPCPTSKCALLNSETGGGVRQDYTPRACTSGLSLAPLDAMDAVAISEWDARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.11
4 0.16
5 0.23
6 0.24
7 0.26
8 0.28
9 0.32
10 0.4
11 0.48
12 0.5
13 0.53
14 0.62
15 0.7
16 0.78
17 0.84
18 0.86
19 0.87
20 0.91
21 0.9
22 0.85
23 0.81
24 0.74
25 0.66
26 0.57
27 0.48
28 0.39
29 0.3
30 0.24
31 0.18
32 0.16
33 0.12
34 0.11
35 0.09
36 0.07
37 0.07
38 0.08
39 0.09
40 0.11
41 0.14
42 0.16
43 0.17
44 0.19
45 0.18
46 0.17
47 0.19
48 0.22
49 0.2
50 0.19
51 0.18
52 0.16
53 0.16
54 0.15
55 0.12
56 0.06
57 0.06
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04