Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NSJ5

Protein Details
Accession A0A5C3NSJ5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-85REREEERRRKEAKKVKQSNALRRSTBasic
NLS Segment(s)
PositionSequence
25-78AKYMRRGELERLKEEQERKAREEEEAKRRQEKEREEREREEERRRKEAKKVKQS
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004098  Prp18  
IPR014906  PRP4-like  
IPR036285  PRP4-like_sf  
IPR039979  PRPF18  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF02840  Prp18  
PF08799  PRP4  
Amino Acid Sequences MDALKAEIANKRKALEIPAVDGRPAKYMRRGELERLKEEQERKAREEEEAKRRQEKEREEREREEERRRKEAKKVKQSNALRRSTASPHPEGGASPAPESTFNISNEETVRRLRAKGQPIRLFGESDKERRLRLRALELIEEKDHERHGGQNDFKKALEDVDKHTQEEAARDKGKKKDKEASLMSDVLDLELVKTDPDKLYPIIYYALKRALKEWEQWMDDRPEHVKRTTQGKLAAATQRQSAEYLKPLFKLLRTRNLQSDVLARIAEIVHHMQMRRYSSANDSYLRLSIGNAPWPIGVTMVGIHERSAREKISTDQVAHVLNDEVSRKYIQSLKRILTFAQTKYPPSDPTQLMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.37
4 0.37
5 0.42
6 0.41
7 0.39
8 0.39
9 0.35
10 0.33
11 0.34
12 0.32
13 0.34
14 0.39
15 0.43
16 0.5
17 0.52
18 0.56
19 0.62
20 0.65
21 0.61
22 0.58
23 0.57
24 0.55
25 0.56
26 0.55
27 0.55
28 0.54
29 0.53
30 0.56
31 0.53
32 0.52
33 0.57
34 0.57
35 0.58
36 0.61
37 0.63
38 0.65
39 0.68
40 0.7
41 0.7
42 0.71
43 0.72
44 0.74
45 0.78
46 0.77
47 0.79
48 0.77
49 0.78
50 0.74
51 0.75
52 0.72
53 0.68
54 0.71
55 0.72
56 0.71
57 0.72
58 0.75
59 0.75
60 0.78
61 0.81
62 0.79
63 0.82
64 0.86
65 0.86
66 0.85
67 0.79
68 0.69
69 0.62
70 0.58
71 0.53
72 0.51
73 0.47
74 0.4
75 0.36
76 0.35
77 0.33
78 0.29
79 0.28
80 0.24
81 0.19
82 0.17
83 0.16
84 0.16
85 0.16
86 0.18
87 0.17
88 0.17
89 0.17
90 0.19
91 0.19
92 0.2
93 0.21
94 0.22
95 0.2
96 0.17
97 0.21
98 0.2
99 0.21
100 0.26
101 0.32
102 0.4
103 0.45
104 0.54
105 0.56
106 0.57
107 0.59
108 0.53
109 0.48
110 0.38
111 0.39
112 0.33
113 0.3
114 0.33
115 0.31
116 0.32
117 0.33
118 0.37
119 0.33
120 0.33
121 0.36
122 0.34
123 0.35
124 0.37
125 0.35
126 0.34
127 0.29
128 0.27
129 0.21
130 0.18
131 0.16
132 0.13
133 0.12
134 0.14
135 0.18
136 0.23
137 0.26
138 0.31
139 0.33
140 0.34
141 0.33
142 0.3
143 0.26
144 0.22
145 0.23
146 0.19
147 0.21
148 0.28
149 0.29
150 0.29
151 0.28
152 0.28
153 0.23
154 0.25
155 0.23
156 0.2
157 0.23
158 0.25
159 0.3
160 0.36
161 0.45
162 0.46
163 0.48
164 0.51
165 0.51
166 0.56
167 0.54
168 0.51
169 0.44
170 0.4
171 0.35
172 0.27
173 0.23
174 0.15
175 0.13
176 0.08
177 0.05
178 0.05
179 0.05
180 0.04
181 0.04
182 0.06
183 0.06
184 0.07
185 0.09
186 0.09
187 0.1
188 0.1
189 0.11
190 0.12
191 0.13
192 0.13
193 0.13
194 0.2
195 0.2
196 0.2
197 0.21
198 0.24
199 0.25
200 0.28
201 0.31
202 0.29
203 0.29
204 0.3
205 0.32
206 0.3
207 0.28
208 0.27
209 0.27
210 0.26
211 0.27
212 0.28
213 0.29
214 0.29
215 0.36
216 0.37
217 0.37
218 0.36
219 0.35
220 0.35
221 0.36
222 0.37
223 0.32
224 0.29
225 0.28
226 0.25
227 0.24
228 0.24
229 0.21
230 0.18
231 0.21
232 0.24
233 0.23
234 0.23
235 0.25
236 0.25
237 0.26
238 0.34
239 0.34
240 0.39
241 0.43
242 0.46
243 0.49
244 0.53
245 0.5
246 0.41
247 0.4
248 0.32
249 0.28
250 0.24
251 0.18
252 0.14
253 0.13
254 0.12
255 0.1
256 0.1
257 0.11
258 0.14
259 0.14
260 0.17
261 0.21
262 0.25
263 0.25
264 0.25
265 0.25
266 0.27
267 0.33
268 0.34
269 0.32
270 0.3
271 0.29
272 0.28
273 0.26
274 0.21
275 0.16
276 0.18
277 0.18
278 0.22
279 0.21
280 0.21
281 0.2
282 0.21
283 0.19
284 0.14
285 0.12
286 0.07
287 0.08
288 0.09
289 0.11
290 0.1
291 0.11
292 0.14
293 0.15
294 0.19
295 0.22
296 0.21
297 0.21
298 0.23
299 0.27
300 0.32
301 0.35
302 0.33
303 0.32
304 0.33
305 0.33
306 0.31
307 0.28
308 0.21
309 0.17
310 0.18
311 0.18
312 0.16
313 0.17
314 0.18
315 0.17
316 0.21
317 0.27
318 0.3
319 0.37
320 0.43
321 0.46
322 0.5
323 0.52
324 0.48
325 0.51
326 0.51
327 0.45
328 0.47
329 0.44
330 0.42
331 0.46
332 0.48
333 0.43
334 0.43
335 0.48