Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PA28

Protein Details
Accession A0A5C3PA28    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-76VYCSKECQRRAWRTHKSCCRPKNTRPAPMAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 9.833, cyto 7.5, cyto_pero 6.166, mito 5, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MKHESFPRRGCLDGHTPGNDTVCHECKTSGGKDTVVLRRCGGCSIAVYCSKECQRRAWRTHKSCCRPKNTRPAPMASDPDEGLPPVPFPIRTDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.36
4 0.36
5 0.36
6 0.3
7 0.26
8 0.26
9 0.25
10 0.24
11 0.23
12 0.22
13 0.22
14 0.27
15 0.26
16 0.24
17 0.22
18 0.21
19 0.23
20 0.29
21 0.33
22 0.32
23 0.31
24 0.27
25 0.27
26 0.27
27 0.25
28 0.19
29 0.13
30 0.11
31 0.11
32 0.13
33 0.14
34 0.15
35 0.14
36 0.17
37 0.22
38 0.26
39 0.26
40 0.32
41 0.4
42 0.48
43 0.56
44 0.63
45 0.69
46 0.72
47 0.81
48 0.83
49 0.83
50 0.84
51 0.84
52 0.84
53 0.82
54 0.82
55 0.83
56 0.81
57 0.8
58 0.74
59 0.71
60 0.68
61 0.64
62 0.6
63 0.53
64 0.46
65 0.38
66 0.35
67 0.3
68 0.24
69 0.2
70 0.15
71 0.12
72 0.12
73 0.14
74 0.13