Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3P9U5

Protein Details
Accession A0A5C3P9U5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQSRKAHRNGIKKPQSHydrophilic
NLS Segment(s)
PositionSequence
14-55RKAHRNGIKKPQSHRTRSMKGVDPKFRRNSRFALVGSRKARA
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQSRKAHRNGIKKPQSHRTRSMKGVDPKFRRNSRFALVGSRKARAEQKAAASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.75
5 0.75
6 0.75
7 0.8
8 0.78
9 0.74
10 0.73
11 0.74
12 0.75
13 0.71
14 0.71
15 0.69
16 0.66
17 0.65
18 0.63
19 0.61
20 0.6
21 0.62
22 0.62
23 0.59
24 0.62
25 0.66
26 0.69
27 0.65
28 0.61
29 0.58
30 0.53
31 0.52
32 0.45
33 0.47
34 0.45
35 0.49
36 0.48
37 0.47
38 0.43
39 0.42
40 0.48
41 0.42
42 0.43
43 0.4