Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PBM7

Protein Details
Accession A0A5C3PBM7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MLLCIRIRTRRCRPRWMPQRTGFRLRRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto_nucl 6.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MLLCIRIRTRRCRPRWMPQRTGFRLRRVCAQCHGSIFTSGPLTNRSHSRAFVDQSHKELMDKKQLSYSSVYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.84
5 0.82
6 0.86
7 0.82
8 0.84
9 0.77
10 0.76
11 0.73
12 0.64
13 0.65
14 0.58
15 0.54
16 0.49
17 0.48
18 0.41
19 0.36
20 0.36
21 0.27
22 0.24
23 0.21
24 0.16
25 0.13
26 0.12
27 0.11
28 0.12
29 0.13
30 0.15
31 0.18
32 0.21
33 0.21
34 0.22
35 0.26
36 0.28
37 0.29
38 0.34
39 0.39
40 0.37
41 0.39
42 0.4
43 0.36
44 0.34
45 0.36
46 0.34
47 0.37
48 0.37
49 0.35
50 0.38
51 0.39
52 0.4