Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P8Q8

Protein Details
Accession A0A5C3P8Q8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-39LGPWRVPRPAKRRRFNAAPKANKRYHCHydrophilic
NLS Segment(s)
PositionSequence
18-34VPRPAKRRRFNAAPKAN
Subcellular Location(s) nucl 11.5, cyto_nucl 8.833, mito 7, cyto 5, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLEVPQVDAPGLLGPWRVPRPAKRRRFNAAPKANKRYHCPWCEEAMDRKSNLNVHIWEQHDPNFVPSQCPHCPKSYTRSNALKAHIRRNMRTFTHLMAPVLRAPPTEFVVIQGAVYVAFAHDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.16
3 0.18
4 0.22
5 0.27
6 0.37
7 0.47
8 0.57
9 0.66
10 0.69
11 0.74
12 0.78
13 0.83
14 0.84
15 0.85
16 0.85
17 0.85
18 0.84
19 0.85
20 0.83
21 0.76
22 0.72
23 0.7
24 0.69
25 0.62
26 0.59
27 0.54
28 0.52
29 0.51
30 0.48
31 0.46
32 0.42
33 0.41
34 0.35
35 0.33
36 0.31
37 0.3
38 0.27
39 0.23
40 0.19
41 0.18
42 0.22
43 0.23
44 0.23
45 0.22
46 0.22
47 0.21
48 0.19
49 0.19
50 0.17
51 0.16
52 0.16
53 0.17
54 0.22
55 0.24
56 0.28
57 0.28
58 0.28
59 0.32
60 0.32
61 0.38
62 0.42
63 0.42
64 0.46
65 0.5
66 0.53
67 0.54
68 0.56
69 0.57
70 0.52
71 0.57
72 0.55
73 0.54
74 0.53
75 0.53
76 0.56
77 0.5
78 0.5
79 0.44
80 0.4
81 0.41
82 0.38
83 0.33
84 0.28
85 0.27
86 0.25
87 0.25
88 0.22
89 0.17
90 0.17
91 0.19
92 0.2
93 0.2
94 0.17
95 0.17
96 0.2
97 0.19
98 0.17
99 0.14
100 0.11
101 0.09
102 0.09
103 0.07