Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P353

Protein Details
Accession A0A5C3P353    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-29IKGLKKEHSHKSSSRHRPECRDALTBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045038  AIG2-like  
IPR009288  AIG2-like_dom  
Pfam View protein in Pfam  
PF06094  GGACT  
Amino Acid Sequences MEGPIKGLKKEHSHKSSSRHRPECRDALTPIHPASSHRSRRWPFTNLSSEHTRHKIKRADYPAVLPYSRSRELFASSGHAGLPPEERTVRGTFVQGFNDHDIHLLDLFEGDEYTRENVEVHALGPLTSLSSTPVPTGKSSISSSSAAVPLDAPSLPPLDAPSAPLPAETYIYAGPLTDLSPELWSLSARTRGSGSGAARTKTITSRLTAGATSTGRRYGRRLSTPPLSRGASRGLNAGDNRIDVVNPHWSTQDPTPAPADYRWLLRSTTIRFTLMSSSDVLPAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.77
4 0.78
5 0.8
6 0.8
7 0.81
8 0.82
9 0.85
10 0.84
11 0.78
12 0.72
13 0.64
14 0.61
15 0.56
16 0.52
17 0.44
18 0.37
19 0.32
20 0.29
21 0.35
22 0.39
23 0.44
24 0.44
25 0.54
26 0.56
27 0.65
28 0.69
29 0.67
30 0.62
31 0.61
32 0.64
33 0.57
34 0.58
35 0.56
36 0.52
37 0.53
38 0.54
39 0.54
40 0.49
41 0.56
42 0.57
43 0.55
44 0.62
45 0.63
46 0.64
47 0.57
48 0.57
49 0.53
50 0.49
51 0.45
52 0.37
53 0.33
54 0.33
55 0.33
56 0.3
57 0.27
58 0.25
59 0.28
60 0.28
61 0.24
62 0.22
63 0.19
64 0.19
65 0.17
66 0.17
67 0.14
68 0.13
69 0.15
70 0.11
71 0.14
72 0.14
73 0.14
74 0.17
75 0.18
76 0.2
77 0.18
78 0.18
79 0.19
80 0.2
81 0.22
82 0.19
83 0.2
84 0.21
85 0.2
86 0.18
87 0.16
88 0.14
89 0.12
90 0.11
91 0.08
92 0.06
93 0.05
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.05
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.07
119 0.07
120 0.09
121 0.1
122 0.1
123 0.12
124 0.11
125 0.12
126 0.13
127 0.14
128 0.15
129 0.15
130 0.15
131 0.14
132 0.15
133 0.12
134 0.11
135 0.1
136 0.07
137 0.08
138 0.07
139 0.06
140 0.05
141 0.06
142 0.06
143 0.06
144 0.07
145 0.07
146 0.08
147 0.1
148 0.1
149 0.11
150 0.11
151 0.11
152 0.11
153 0.09
154 0.1
155 0.08
156 0.08
157 0.07
158 0.08
159 0.08
160 0.07
161 0.06
162 0.06
163 0.06
164 0.05
165 0.06
166 0.06
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.08
173 0.1
174 0.16
175 0.16
176 0.16
177 0.17
178 0.17
179 0.19
180 0.22
181 0.2
182 0.22
183 0.25
184 0.25
185 0.24
186 0.25
187 0.24
188 0.22
189 0.26
190 0.2
191 0.18
192 0.2
193 0.22
194 0.22
195 0.2
196 0.18
197 0.18
198 0.18
199 0.18
200 0.16
201 0.21
202 0.22
203 0.24
204 0.27
205 0.31
206 0.38
207 0.44
208 0.48
209 0.49
210 0.56
211 0.6
212 0.6
213 0.57
214 0.51
215 0.44
216 0.41
217 0.4
218 0.34
219 0.29
220 0.29
221 0.24
222 0.27
223 0.27
224 0.28
225 0.23
226 0.2
227 0.21
228 0.18
229 0.16
230 0.12
231 0.15
232 0.21
233 0.2
234 0.21
235 0.21
236 0.22
237 0.26
238 0.29
239 0.36
240 0.27
241 0.29
242 0.31
243 0.31
244 0.32
245 0.28
246 0.31
247 0.23
248 0.27
249 0.27
250 0.26
251 0.25
252 0.28
253 0.34
254 0.34
255 0.39
256 0.37
257 0.36
258 0.35
259 0.36
260 0.36
261 0.31
262 0.27
263 0.22
264 0.21
265 0.23