Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3P7F4

Protein Details
Accession A0A5C3P7F4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
102-123PESAVRTKWEQRQERKAPRGYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01658  Ribosomal_L30  
Amino Acid Sequences MFTAAASLRSCASSLAKAQCRRSLATSAASSTAQSSTTTGEPLTHYRITLRRSAISLPQNIKGTLEALGIHRRLQTVYHRHTPDIAGKILTVKELVTVENVPESAVRTKWEQRQERKAPRGYSVTGSKLQVDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.37
4 0.43
5 0.48
6 0.51
7 0.52
8 0.52
9 0.49
10 0.44
11 0.39
12 0.38
13 0.34
14 0.3
15 0.28
16 0.25
17 0.22
18 0.19
19 0.16
20 0.12
21 0.11
22 0.1
23 0.11
24 0.11
25 0.11
26 0.1
27 0.11
28 0.12
29 0.14
30 0.18
31 0.16
32 0.16
33 0.19
34 0.24
35 0.25
36 0.28
37 0.28
38 0.24
39 0.25
40 0.27
41 0.3
42 0.29
43 0.32
44 0.3
45 0.31
46 0.31
47 0.3
48 0.28
49 0.22
50 0.18
51 0.13
52 0.11
53 0.08
54 0.08
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.12
61 0.14
62 0.2
63 0.25
64 0.31
65 0.38
66 0.39
67 0.39
68 0.4
69 0.39
70 0.37
71 0.31
72 0.27
73 0.19
74 0.17
75 0.19
76 0.18
77 0.16
78 0.11
79 0.08
80 0.09
81 0.09
82 0.09
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.08
89 0.08
90 0.11
91 0.12
92 0.12
93 0.14
94 0.18
95 0.26
96 0.33
97 0.43
98 0.5
99 0.57
100 0.67
101 0.76
102 0.81
103 0.83
104 0.84
105 0.77
106 0.74
107 0.7
108 0.62
109 0.58
110 0.53
111 0.49
112 0.46
113 0.44