Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3P348

Protein Details
Accession A0A5C3P348    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-36HASASNGRRRRRHRHCLFSACHHydrophilic
NLS Segment(s)
PositionSequence
24-25RR
Subcellular Location(s) mito 18, nucl 5, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MPAPSPSWLLLCTAHASASNGRRRRRHRHCLFSACHRMSTSLCISTTPSSVPTHMVAPSGENAKCVPRALPNPVFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.2
5 0.27
6 0.34
7 0.38
8 0.45
9 0.54
10 0.62
11 0.7
12 0.75
13 0.78
14 0.79
15 0.83
16 0.84
17 0.83
18 0.79
19 0.77
20 0.76
21 0.66
22 0.57
23 0.47
24 0.4
25 0.31
26 0.31
27 0.24
28 0.16
29 0.15
30 0.14
31 0.16
32 0.15
33 0.16
34 0.12
35 0.13
36 0.12
37 0.13
38 0.14
39 0.13
40 0.14
41 0.14
42 0.14
43 0.12
44 0.12
45 0.14
46 0.17
47 0.16
48 0.16
49 0.16
50 0.19
51 0.2
52 0.2
53 0.2
54 0.23
55 0.29
56 0.37