Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PI78

Protein Details
Accession A0A5C3PI78    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
145-166VTDAPLKKKRGRPPKDPHPDLEBasic
NLS Segment(s)
PositionSequence
108-122PKRARGRPLGSKNKK
150-160LKKKRGRPPKD
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MLQMDGSHGALRTIHEDAPVDPLESPATASATNFRLSLTSTTGSTPPHLRNQPRRIIAPTHRRQRAQPVKRRSCTPTSIPNPGVGTPERPLDNAPTAVSVPTTQDAPPKRARGRPLGSKNKKSLATSPDSKPESTSGTAASRSGVTDAPLKKKRGRPPKDPHPDLEDLEEPLRKRWKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.21
6 0.21
7 0.18
8 0.15
9 0.15
10 0.15
11 0.14
12 0.14
13 0.1
14 0.1
15 0.1
16 0.1
17 0.13
18 0.14
19 0.15
20 0.14
21 0.14
22 0.13
23 0.14
24 0.16
25 0.16
26 0.15
27 0.15
28 0.16
29 0.18
30 0.18
31 0.19
32 0.22
33 0.22
34 0.29
35 0.36
36 0.44
37 0.53
38 0.6
39 0.65
40 0.64
41 0.64
42 0.59
43 0.59
44 0.59
45 0.59
46 0.61
47 0.62
48 0.64
49 0.62
50 0.61
51 0.65
52 0.67
53 0.66
54 0.67
55 0.68
56 0.72
57 0.74
58 0.76
59 0.7
60 0.64
61 0.59
62 0.54
63 0.53
64 0.47
65 0.5
66 0.45
67 0.42
68 0.38
69 0.33
70 0.31
71 0.21
72 0.19
73 0.14
74 0.15
75 0.14
76 0.13
77 0.13
78 0.13
79 0.14
80 0.13
81 0.12
82 0.1
83 0.1
84 0.1
85 0.1
86 0.07
87 0.07
88 0.07
89 0.08
90 0.08
91 0.13
92 0.15
93 0.2
94 0.25
95 0.32
96 0.36
97 0.39
98 0.44
99 0.47
100 0.52
101 0.57
102 0.62
103 0.66
104 0.71
105 0.74
106 0.74
107 0.71
108 0.67
109 0.6
110 0.56
111 0.5
112 0.48
113 0.47
114 0.45
115 0.47
116 0.46
117 0.44
118 0.39
119 0.35
120 0.32
121 0.28
122 0.25
123 0.19
124 0.19
125 0.2
126 0.18
127 0.17
128 0.14
129 0.12
130 0.13
131 0.11
132 0.11
133 0.17
134 0.22
135 0.31
136 0.37
137 0.42
138 0.49
139 0.57
140 0.66
141 0.7
142 0.74
143 0.75
144 0.79
145 0.85
146 0.88
147 0.84
148 0.79
149 0.75
150 0.71
151 0.62
152 0.57
153 0.47
154 0.39
155 0.38
156 0.37
157 0.31
158 0.33