Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PBU9

Protein Details
Accession A0A5C3PBU9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-38QLRAQPPTFFRRCRRRRRRPRSHPARQFVSLHydrophilic
NLS Segment(s)
PositionSequence
20-34CRRRRRRPRSHPARQ
43-43R
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPSNHTQLRAQPPTFFRRCRRRRRRPRSHPARQFVSLPTSRRRRARCSVLAARPDELSLGPCATQHALIDTGLVLDLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.6
4 0.59
5 0.63
6 0.72
7 0.77
8 0.83
9 0.86
10 0.9
11 0.94
12 0.96
13 0.96
14 0.97
15 0.96
16 0.96
17 0.95
18 0.9
19 0.84
20 0.75
21 0.65
22 0.55
23 0.5
24 0.43
25 0.36
26 0.36
27 0.38
28 0.42
29 0.47
30 0.51
31 0.52
32 0.56
33 0.62
34 0.6
35 0.62
36 0.65
37 0.64
38 0.64
39 0.58
40 0.51
41 0.43
42 0.36
43 0.28
44 0.2
45 0.15
46 0.11
47 0.1
48 0.09
49 0.09
50 0.11
51 0.11
52 0.12
53 0.11
54 0.11
55 0.12
56 0.12
57 0.12
58 0.1
59 0.09