Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3P149

Protein Details
Accession A0A5C3P149    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-29PTRLRYQRCHLRARPLRKMWHydrophilic
59-81TTSASRTVRPRRNQPRPRPSGVPHydrophilic
NLS Segment(s)
PositionSequence
73-75PRP
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MQAFQTQPAPTRLRYQRCHLRARPLRKMWELSWAPLWAAFWASPCLASSYIMFCSVEGTTSASRTVRPRRNQPRPRPSGVPRHARTQTGPCRFCPHIRCRYTTQMTRVPSLHLQPPGRRRPSHLALLPRGWVRPLSDTCARSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.66
4 0.69
5 0.78
6 0.73
7 0.75
8 0.75
9 0.8
10 0.8
11 0.77
12 0.77
13 0.72
14 0.72
15 0.61
16 0.62
17 0.53
18 0.45
19 0.41
20 0.34
21 0.29
22 0.24
23 0.23
24 0.13
25 0.13
26 0.1
27 0.09
28 0.1
29 0.1
30 0.09
31 0.09
32 0.11
33 0.1
34 0.11
35 0.1
36 0.1
37 0.11
38 0.12
39 0.11
40 0.09
41 0.1
42 0.09
43 0.09
44 0.07
45 0.09
46 0.09
47 0.09
48 0.11
49 0.09
50 0.12
51 0.18
52 0.27
53 0.33
54 0.39
55 0.49
56 0.59
57 0.7
58 0.78
59 0.82
60 0.84
61 0.82
62 0.81
63 0.77
64 0.72
65 0.71
66 0.68
67 0.68
68 0.59
69 0.6
70 0.57
71 0.52
72 0.49
73 0.48
74 0.5
75 0.5
76 0.49
77 0.43
78 0.47
79 0.48
80 0.51
81 0.5
82 0.49
83 0.5
84 0.52
85 0.55
86 0.55
87 0.62
88 0.63
89 0.61
90 0.58
91 0.54
92 0.54
93 0.53
94 0.47
95 0.42
96 0.37
97 0.35
98 0.34
99 0.35
100 0.37
101 0.41
102 0.5
103 0.56
104 0.6
105 0.58
106 0.6
107 0.62
108 0.63
109 0.65
110 0.62
111 0.6
112 0.58
113 0.59
114 0.56
115 0.49
116 0.44
117 0.36
118 0.32
119 0.27
120 0.29
121 0.29
122 0.31
123 0.37