Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NQX0

Protein Details
Accession A0A5C3NQX0    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-78AAKLKNAKELRRERNKRYYQRCKERRALPSRTSESKAQDLRRERNRRYNQRRKEGRTPATNTHydrophilic
NLS Segment(s)
PositionSequence
21-70KNAKELRRERNKRYYQRCKERRALPSRTSESKAQDLRRERNRRYNQRRKE
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MPPSQTPPELTGDPQVAAKLKNAKELRRERNKRYYQRCKERRALPSRTSESKAQDLRRERNRRYNQRRKEGRTPATNTAGLIGEKTLHQAQSQSELLLNLGRLEYNEQVAQVAVSSSYLYRKPIRIALCPCFEYNYRLKSLNAALSAWNLVDDTAQFSSLLAEEIARAGEEDNGQQWSFLRQEWLVQGDKLLDEMQDIVGSEFIDDMRPEVRSDLWADISSAAFKVRYMMSIVQAQLHTFKRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.21
5 0.24
6 0.28
7 0.28
8 0.37
9 0.42
10 0.46
11 0.54
12 0.63
13 0.69
14 0.71
15 0.79
16 0.79
17 0.84
18 0.89
19 0.89
20 0.9
21 0.91
22 0.9
23 0.93
24 0.93
25 0.91
26 0.89
27 0.88
28 0.87
29 0.85
30 0.82
31 0.77
32 0.77
33 0.75
34 0.71
35 0.66
36 0.61
37 0.56
38 0.56
39 0.56
40 0.52
41 0.53
42 0.56
43 0.62
44 0.67
45 0.72
46 0.71
47 0.75
48 0.81
49 0.84
50 0.87
51 0.88
52 0.88
53 0.89
54 0.92
55 0.9
56 0.89
57 0.88
58 0.85
59 0.83
60 0.78
61 0.73
62 0.67
63 0.59
64 0.49
65 0.4
66 0.33
67 0.24
68 0.18
69 0.12
70 0.08
71 0.07
72 0.1
73 0.1
74 0.1
75 0.1
76 0.12
77 0.12
78 0.16
79 0.17
80 0.14
81 0.13
82 0.13
83 0.13
84 0.12
85 0.11
86 0.06
87 0.06
88 0.05
89 0.05
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.05
99 0.05
100 0.03
101 0.03
102 0.03
103 0.04
104 0.06
105 0.07
106 0.1
107 0.12
108 0.14
109 0.15
110 0.2
111 0.22
112 0.27
113 0.31
114 0.32
115 0.33
116 0.33
117 0.32
118 0.29
119 0.27
120 0.25
121 0.25
122 0.23
123 0.23
124 0.23
125 0.23
126 0.23
127 0.24
128 0.22
129 0.19
130 0.16
131 0.14
132 0.13
133 0.14
134 0.11
135 0.08
136 0.06
137 0.05
138 0.05
139 0.04
140 0.06
141 0.06
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.05
149 0.05
150 0.04
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.06
157 0.06
158 0.07
159 0.08
160 0.1
161 0.1
162 0.1
163 0.1
164 0.12
165 0.12
166 0.12
167 0.14
168 0.12
169 0.14
170 0.16
171 0.19
172 0.18
173 0.17
174 0.17
175 0.15
176 0.15
177 0.14
178 0.12
179 0.08
180 0.07
181 0.08
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.08
194 0.09
195 0.1
196 0.11
197 0.12
198 0.13
199 0.13
200 0.16
201 0.17
202 0.18
203 0.18
204 0.18
205 0.17
206 0.17
207 0.16
208 0.14
209 0.12
210 0.1
211 0.1
212 0.12
213 0.12
214 0.12
215 0.16
216 0.17
217 0.2
218 0.24
219 0.25
220 0.26
221 0.26
222 0.26
223 0.28
224 0.28