Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PZ01

Protein Details
Accession A0A5C3PZ01    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-75APLRSARGYKRKPRPNIPDKRKPRARMPHPTNREBasic
NLS Segment(s)
PositionSequence
44-69LRSARGYKRKPRPNIPDKRKPRARMP
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLGGDYRPRIIMGKMVTVKHDPCRTAHMRPLVVKQRSSSAHAPLRSARGYKRKPRPNIPDKRKPRARMPHPTNREEIVSDRSDAIRLRGDTRCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.31
4 0.34
5 0.37
6 0.39
7 0.42
8 0.35
9 0.32
10 0.4
11 0.41
12 0.41
13 0.44
14 0.43
15 0.42
16 0.43
17 0.5
18 0.51
19 0.5
20 0.46
21 0.41
22 0.4
23 0.39
24 0.41
25 0.35
26 0.33
27 0.35
28 0.34
29 0.35
30 0.31
31 0.32
32 0.28
33 0.27
34 0.26
35 0.31
36 0.38
37 0.46
38 0.55
39 0.61
40 0.67
41 0.75
42 0.8
43 0.81
44 0.84
45 0.84
46 0.85
47 0.85
48 0.88
49 0.87
50 0.81
51 0.81
52 0.81
53 0.8
54 0.81
55 0.81
56 0.81
57 0.8
58 0.78
59 0.71
60 0.62
61 0.54
62 0.45
63 0.39
64 0.34
65 0.28
66 0.26
67 0.24
68 0.23
69 0.24
70 0.23
71 0.22
72 0.23
73 0.24
74 0.27