FuNGI

A0A5C3PJS9

Protein Details

Accession

A0A5C3PJS9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
506-531	PFVLQKFGNRLRRKSKYAPSAPPAPP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 26

Family & Domain DBs

InterPro	View protein in InterPro IPR011701 MFS IPR020846 MFS_dom IPR036259 MFS_trans_sf
Gene Ontology	GO:0016020 C:membrane GO:0022857 F:transmembrane transporter activity
Pfam	View protein in Pfam PF07690 MFS_1
PROSITE	View protein in PROSITE PS50850 MFS
CDD	cd17323 MFS_Tpo1_MDR_like

Amino Acid Sequences

MAARPASANAPGTQEVSTTELSSRTPTFVESQDHPQDAEDVNSEFEHEAYGPAPGEKPVDSYEVIMGPSDPDNPKTWKHWYRWYITALSAILVLNATFASSAPSGIVRQLMEEFTFSTEVATLTIALFVAGYCVGPLLWGPLSEQVGRKPVFVASFIVYTGFQVGCALAPNTAAILVFRFLGGTFAAAPLANSGAVMADIWDADTRGKALALFTLAPFAGPALGPTVSGFMTVSGVSWRWVFWVQTIFAGVCLLFVIFTLPETYVPILLVRRAEKLRKETGDTRYWAPLERNKKTFSQHVKHVLARPFLILFREPMLIAITLYMSFIYGVMYLLFEAYPIVFTIGHGFNEGISGLMFLPIFIGGAIGVAIYLIVFNPAYYRAMQKYAPAPVPPEFRLGPCLWAAPIYTMSFFWFGWTSYPSVSYWAPLMAGVPMGCAIVFLFNGLFNYTIDAYLFVAASALSSMTVVRSLFGAGFPLFATQMYETLNPRWASTLLGLIALVMTPIPFVLQKFGNRLRRKSKYAPSAPPAPPVTGEKKQAV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.19
3	0.2
4	0.19
5	0.16
6	0.16
7	0.16
8	0.16
9	0.2
10	0.2
11	0.19
12	0.18
13	0.19
14	0.22
15	0.25
16	0.29
17	0.29
18	0.36
19	0.41
20	0.41
21	0.39
22	0.36
23	0.35
24	0.3
25	0.28
26	0.21
27	0.16
28	0.17
29	0.16
30	0.17
31	0.14
32	0.13
33	0.12
34	0.1
35	0.1
36	0.09
37	0.11
38	0.1
39	0.11
40	0.12
41	0.12
42	0.14
43	0.13
44	0.16
45	0.16
46	0.19
47	0.18
48	0.18
49	0.19
50	0.18
51	0.18
52	0.16
53	0.14
54	0.12
55	0.13
56	0.17
57	0.17
58	0.18
59	0.22
60	0.26
61	0.3
62	0.33
63	0.43
64	0.45
65	0.5
66	0.58
67	0.61
68	0.63
69	0.65
70	0.64
71	0.57
72	0.49
73	0.46
74	0.36
75	0.29
76	0.23
77	0.17
78	0.13
79	0.1
80	0.09
81	0.06
82	0.05
83	0.05
84	0.04
85	0.04
86	0.07
87	0.07
88	0.07
89	0.08
90	0.09
91	0.1
92	0.11
93	0.13
94	0.1
95	0.11
96	0.12
97	0.13
98	0.12
99	0.13
100	0.12
101	0.12
102	0.13
103	0.11
104	0.1
105	0.09
106	0.09
107	0.09
108	0.08
109	0.06
110	0.06
111	0.06
112	0.06
113	0.05
114	0.05
115	0.04
116	0.05
117	0.04
118	0.04
119	0.04
120	0.04
121	0.04
122	0.04
123	0.04
124	0.06
125	0.06
126	0.06
127	0.07
128	0.11
129	0.13
130	0.16
131	0.17
132	0.17
133	0.24
134	0.25
135	0.24
136	0.22
137	0.22
138	0.2
139	0.2
140	0.2
141	0.14
142	0.14
143	0.14
144	0.13
145	0.11
146	0.1
147	0.11
148	0.09
149	0.07
150	0.07
151	0.07
152	0.06
153	0.07
154	0.08
155	0.06
156	0.06
157	0.06
158	0.06
159	0.06
160	0.05
161	0.04
162	0.05
163	0.05
164	0.05
165	0.05
166	0.05
167	0.05
168	0.06
169	0.05
170	0.05
171	0.05
172	0.05
173	0.06
174	0.05
175	0.05
176	0.05
177	0.05
178	0.05
179	0.04
180	0.04
181	0.04
182	0.04
183	0.03
184	0.03
185	0.03
186	0.03
187	0.04
188	0.04
189	0.04
190	0.05
191	0.05
192	0.05
193	0.05
194	0.06
195	0.05
196	0.06
197	0.06
198	0.07
199	0.07
200	0.07
201	0.08
202	0.07
203	0.07
204	0.06
205	0.06
206	0.05
207	0.04
208	0.04
209	0.05
210	0.05
211	0.05
212	0.05
213	0.07
214	0.06
215	0.06
216	0.06
217	0.05
218	0.05
219	0.05
220	0.05
221	0.05
222	0.06
223	0.06
224	0.06
225	0.06
226	0.07
227	0.08
228	0.08
229	0.09
230	0.12
231	0.11
232	0.11
233	0.12
234	0.1
235	0.09
236	0.09
237	0.07
238	0.04
239	0.04
240	0.03
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.04
247	0.04
248	0.04
249	0.05
250	0.06
251	0.05
252	0.06
253	0.06
254	0.06
255	0.07
256	0.09
257	0.09
258	0.13
259	0.15
260	0.19
261	0.22
262	0.27
263	0.32
264	0.32
265	0.36
266	0.39
267	0.42
268	0.43
269	0.41
270	0.38
271	0.34
272	0.33
273	0.3
274	0.27
275	0.28
276	0.32
277	0.35
278	0.37
279	0.37
280	0.39
281	0.41
282	0.46
283	0.49
284	0.46
285	0.47
286	0.52
287	0.53
288	0.54
289	0.57
290	0.52
291	0.44
292	0.39
293	0.33
294	0.25
295	0.22
296	0.2
297	0.14
298	0.11
299	0.11
300	0.11
301	0.1
302	0.1
303	0.1
304	0.08
305	0.08
306	0.07
307	0.06
308	0.05
309	0.05
310	0.05
311	0.04
312	0.04
313	0.04
314	0.04
315	0.04
316	0.04
317	0.04
318	0.04
319	0.04
320	0.04
321	0.04
322	0.04
323	0.03
324	0.03
325	0.04
326	0.04
327	0.05
328	0.04
329	0.05
330	0.09
331	0.1
332	0.1
333	0.1
334	0.1
335	0.09
336	0.1
337	0.1
338	0.05
339	0.04
340	0.05
341	0.04
342	0.05
343	0.05
344	0.04
345	0.05
346	0.05
347	0.05
348	0.04
349	0.04
350	0.03
351	0.03
352	0.03
353	0.02
354	0.02
355	0.02
356	0.02
357	0.02
358	0.02
359	0.02
360	0.03
361	0.03
362	0.03
363	0.04
364	0.06
365	0.07
366	0.08
367	0.12
368	0.13
369	0.17
370	0.17
371	0.2
372	0.23
373	0.27
374	0.28
375	0.26
376	0.27
377	0.28
378	0.33
379	0.3
380	0.31
381	0.26
382	0.25
383	0.29
384	0.26
385	0.24
386	0.19
387	0.19
388	0.15
389	0.15
390	0.14
391	0.11
392	0.12
393	0.11
394	0.11
395	0.11
396	0.12
397	0.13
398	0.13
399	0.13
400	0.12
401	0.11
402	0.13
403	0.14
404	0.14
405	0.13
406	0.14
407	0.13
408	0.15
409	0.15
410	0.14
411	0.13
412	0.12
413	0.11
414	0.1
415	0.1
416	0.07
417	0.08
418	0.07
419	0.06
420	0.06
421	0.06
422	0.06
423	0.05
424	0.05
425	0.05
426	0.05
427	0.05
428	0.05
429	0.06
430	0.07
431	0.07
432	0.08
433	0.07
434	0.1
435	0.1
436	0.1
437	0.1
438	0.1
439	0.1
440	0.1
441	0.09
442	0.07
443	0.06
444	0.06
445	0.06
446	0.05
447	0.05
448	0.04
449	0.04
450	0.04
451	0.05
452	0.07
453	0.07
454	0.07
455	0.07
456	0.08
457	0.08
458	0.08
459	0.11
460	0.09
461	0.1
462	0.09
463	0.1
464	0.09
465	0.09
466	0.11
467	0.09
468	0.11
469	0.13
470	0.15
471	0.17
472	0.19
473	0.26
474	0.24
475	0.24
476	0.25
477	0.23
478	0.23
479	0.21
480	0.22
481	0.16
482	0.16
483	0.15
484	0.12
485	0.12
486	0.09
487	0.08
488	0.04
489	0.04
490	0.03
491	0.04
492	0.05
493	0.06
494	0.07
495	0.12
496	0.16
497	0.2
498	0.29
499	0.39
500	0.48
501	0.55
502	0.64
503	0.7
504	0.75
505	0.8
506	0.81
507	0.82
508	0.83
509	0.84
510	0.84
511	0.8
512	0.82
513	0.75
514	0.73
515	0.65
516	0.56
517	0.49
518	0.46
519	0.48
520	0.44

A0A5C3PJS9

3D AlphaFold-predicted Structure Viewer