Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PFC4

Protein Details
Accession A0A5C3PFC4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-53IICAWKIISRRTRNRRRGNRASVLPEHydrophilic
NLS Segment(s)
PositionSequence
41-43NRR
Subcellular Location(s) mito 9cyto 9cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MATHVAAVGFTPYEQPRMSYTKYLERRIICAWKIISRRTRNRRRGNRASVLPEDFVLLTARRRSVRYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.19
4 0.24
5 0.27
6 0.27
7 0.29
8 0.36
9 0.43
10 0.46
11 0.48
12 0.44
13 0.44
14 0.44
15 0.46
16 0.36
17 0.34
18 0.31
19 0.3
20 0.32
21 0.35
22 0.39
23 0.43
24 0.53
25 0.6
26 0.69
27 0.74
28 0.82
29 0.87
30 0.89
31 0.9
32 0.88
33 0.86
34 0.81
35 0.77
36 0.7
37 0.62
38 0.52
39 0.42
40 0.34
41 0.26
42 0.21
43 0.17
44 0.13
45 0.15
46 0.18
47 0.23
48 0.25