Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3PF23

Protein Details
Accession A0A5C3PF23    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-103PFVHRRSRSSCPPRRPRRPNSSWTSTHydrophilic
121-141AVSRARWQRTRRRHAACHLDSHydrophilic
NLS Segment(s)
PositionSequence
147-152RRRRPG
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTSNGLQQAVPWLTTSGHCISYRVECNPGNAELVLLISRDFGYSHVDSPRHPVSSYVTRRMTGPPNRASRGSRSEFGPFVHRRSRSSCPPRRPRRPNSSWTSTTTSPPLLPPTCSPPVSLAVSRARWQRTRRRHAACHLDSVHRPVRRRRPGSSPHVPATERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.17
4 0.2
5 0.2
6 0.21
7 0.22
8 0.28
9 0.32
10 0.29
11 0.33
12 0.29
13 0.32
14 0.34
15 0.33
16 0.27
17 0.22
18 0.2
19 0.14
20 0.14
21 0.11
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.07
29 0.12
30 0.13
31 0.16
32 0.19
33 0.2
34 0.2
35 0.26
36 0.29
37 0.25
38 0.24
39 0.23
40 0.24
41 0.34
42 0.38
43 0.4
44 0.38
45 0.37
46 0.38
47 0.41
48 0.44
49 0.41
50 0.43
51 0.43
52 0.47
53 0.49
54 0.5
55 0.48
56 0.45
57 0.45
58 0.42
59 0.36
60 0.32
61 0.32
62 0.3
63 0.29
64 0.31
65 0.25
66 0.26
67 0.31
68 0.3
69 0.3
70 0.34
71 0.39
72 0.42
73 0.51
74 0.55
75 0.6
76 0.7
77 0.78
78 0.84
79 0.88
80 0.87
81 0.87
82 0.85
83 0.83
84 0.8
85 0.77
86 0.69
87 0.64
88 0.6
89 0.51
90 0.46
91 0.39
92 0.32
93 0.25
94 0.23
95 0.24
96 0.2
97 0.21
98 0.2
99 0.25
100 0.28
101 0.28
102 0.28
103 0.24
104 0.26
105 0.28
106 0.26
107 0.24
108 0.25
109 0.27
110 0.31
111 0.35
112 0.37
113 0.41
114 0.48
115 0.55
116 0.61
117 0.69
118 0.74
119 0.77
120 0.79
121 0.82
122 0.85
123 0.77
124 0.74
125 0.68
126 0.63
127 0.57
128 0.56
129 0.54
130 0.48
131 0.52
132 0.53
133 0.61
134 0.66
135 0.7
136 0.69
137 0.71
138 0.76
139 0.79
140 0.8
141 0.76
142 0.71
143 0.7