Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PMS2

Protein Details
Accession A0A5C3PMS2    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
69-92LPAHTPKTKTKTKKPSPNARPGPSHydrophilic
165-196QISQLVPAERKRRPRKAKKRVAKKAQGVRAAPHydrophilic
NLS Segment(s)
PositionSequence
79-83KTKKP
173-190ERKRRPRKAKKRVAKKAQ
Subcellular Location(s) nucl 16, mito 4, pero 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MHTNLDYAIASVLERGQALDIPNVFAVYLQRIVACELSDGVPVAETEAIARAALVSFERAMDKYPMAPLPAHTPKTKTKTKKPSPNARPGPSAQTTAPGAKRYSVEVEQLRWDYQKAMWRATMGYDDPGCTCLSCGSLLALREKAELLSAQCEDLIARCEEWEQQISQLVPAERKRRPRKAKKRVAKKAQGVRAAPPFDPYAPSTSAAMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.1
5 0.12
6 0.15
7 0.15
8 0.15
9 0.15
10 0.15
11 0.14
12 0.12
13 0.12
14 0.11
15 0.12
16 0.11
17 0.11
18 0.12
19 0.13
20 0.14
21 0.12
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.08
28 0.08
29 0.07
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.08
47 0.1
48 0.12
49 0.12
50 0.12
51 0.14
52 0.14
53 0.14
54 0.14
55 0.14
56 0.2
57 0.26
58 0.28
59 0.27
60 0.31
61 0.37
62 0.44
63 0.51
64 0.51
65 0.56
66 0.64
67 0.73
68 0.79
69 0.82
70 0.86
71 0.86
72 0.88
73 0.86
74 0.79
75 0.72
76 0.63
77 0.59
78 0.49
79 0.43
80 0.32
81 0.26
82 0.23
83 0.23
84 0.23
85 0.19
86 0.18
87 0.17
88 0.17
89 0.16
90 0.18
91 0.16
92 0.19
93 0.18
94 0.18
95 0.19
96 0.2
97 0.19
98 0.16
99 0.16
100 0.12
101 0.13
102 0.19
103 0.18
104 0.19
105 0.18
106 0.19
107 0.18
108 0.18
109 0.18
110 0.12
111 0.12
112 0.11
113 0.11
114 0.11
115 0.12
116 0.11
117 0.09
118 0.08
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.09
125 0.1
126 0.12
127 0.13
128 0.12
129 0.13
130 0.13
131 0.12
132 0.11
133 0.11
134 0.09
135 0.11
136 0.11
137 0.1
138 0.1
139 0.1
140 0.09
141 0.09
142 0.11
143 0.09
144 0.08
145 0.09
146 0.1
147 0.11
148 0.14
149 0.15
150 0.14
151 0.14
152 0.17
153 0.17
154 0.17
155 0.19
156 0.18
157 0.22
158 0.28
159 0.35
160 0.38
161 0.49
162 0.58
163 0.66
164 0.75
165 0.81
166 0.86
167 0.89
168 0.95
169 0.95
170 0.96
171 0.96
172 0.96
173 0.95
174 0.93
175 0.92
176 0.89
177 0.86
178 0.77
179 0.72
180 0.69
181 0.62
182 0.52
183 0.45
184 0.4
185 0.32
186 0.34
187 0.29
188 0.25
189 0.24
190 0.25